Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Small conductance calcium-activated potassium channel protein 1

Gene

Kcnn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin (By similarity).By similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Keywords - Ligandi

Calmodulin-binding

Protein family/group databases

TCDBi9.A.48.1.1. the unconventional protein secretion (ups) system.

Names & Taxonomyi

Protein namesi
Recommended name:
Small conductance calcium-activated potassium channel protein 1
Short name:
SK1
Short name:
SKCa 1
Short name:
SKCa1
Alternative name(s):
KCa2.1
Gene namesi
Name:Kcnn1
Synonyms:Sk1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1933993. Kcnn1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei108 – 12821Helical; Name=Segment S1Sequence analysisAdd
BLAST
Transmembranei137 – 15721Helical; Name=Segment S2Sequence analysisAdd
BLAST
Transmembranei176 – 19621Helical; Name=Segment S3Sequence analysisAdd
BLAST
Transmembranei225 – 24521Helical; Name=Segment S4Sequence analysisAdd
BLAST
Transmembranei274 – 29421Helical; Name=Segment S5Sequence analysisAdd
BLAST
Intramembranei314 – 33421Pore-forming; Name=Segment H5Sequence analysisAdd
BLAST

GO - Cellular componenti

  • cytoplasm Source: MGI
  • integral component of membrane Source: UniProtKB-KW
  • neuronal cell body Source: GO_Central
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 537537Small conductance calcium-activated potassium channel protein 1PRO_0000155008Add
BLAST

Proteomic databases

MaxQBiQ9EQR3.
PaxDbiQ9EQR3.
PeptideAtlasiQ9EQR3.
PRIDEiQ9EQR3.

Expressioni

Tissue specificityi

Highest expression in brain and liver with lower levels in heart, testis, kidney and colon. In colon, detected in smooth muscle cells. Expressed in atrial and ventricular myocytes with higher levels in atrial myocytes.2 Publications

Gene expression databases

BgeeiENSMUSG00000002908.

Interactioni

Subunit structurei

Heterooligomer. The complex is composed of 4 channel subunits each of which binds to a calmodulin subunit which regulates the channel activity through calcium-binding (By similarity). Interacts with calmodulin.By similarity1 Publication

GO - Molecular functioni

  • calmodulin binding Source: MGI

Protein-protein interaction databases

MINTiMINT-4998195.
STRINGi10090.ENSMUSP00000105705.

Structurei

3D structure databases

ProteinModelPortaliQ9EQR3.
SMRiQ9EQR3. Positions 364-458.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni343 – 36321Segment S6Sequence analysisAdd
BLAST
Regioni381 – 46080Calmodulin-bindingBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi64 – 7512Poly-GluAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3684. Eukaryota.
ENOG410XT9D. LUCA.
HOGENOMiHOG000276908.
HOVERGENiHBG052241.
InParanoidiQ9EQR3.
KOiK04942.
PhylomeDBiQ9EQR3.

Family and domain databases

InterProiIPR004178. CaM-bd_dom.
IPR015449. K_chnl_Ca-activ_SK.
IPR013099. K_chnl_dom.
[Graphical view]
PANTHERiPTHR10153. PTHR10153. 1 hit.
PfamiPF02888. CaMBD. 1 hit.
PF07885. Ion_trans_2. 1 hit.
PF03530. SK_channel. 1 hit.
[Graphical view]
PRINTSiPR01451. SKCHANNEL.
SMARTiSM01053. CaMBD. 1 hit.
[Graphical view]
SUPFAMiSSF81327. SSF81327. 1 hit.

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Note: At least 16 isoforms may be produced by combinatorial splicing of the N-terminal exon 3.1 and the C-terminal exons 7, 8a and 9. Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9EQR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSHSHNGSV GQPLGSGPGF LGWEPVDPEA GRPLQPTQGP GLQMVAKGQP
60 70 80 90 100
VRLSPGGSRG HPQEQEEEEE EEEEEDKTGS GKPPTVSHRL GHRRALFEKR
110 120 130 140 150
KRLSDYALIF GMFGIVVMVT ETELSWGVYT KESLCSFALK CLISLSTVIL
160 170 180 190 200
LGLVILYHAR EIQLFLVDNG ADDWRIAMTW ERVSLISLEL VVCAIHPVPG
210 220 230 240 250
HYRFTWTARL AFSLVPSAAE ADLDVLLSIP MFLRLYLLAR VMLLHSRIFT
260 270 280 290 300
DASSRSIGAL NRVTFNTRFV TKTLMTICPG TVLLVFSVSS WIVAAWTVRV
310 320 330 340 350
CERYHDKQEV TSNFLGAMWL ISITFLSIGY GDMVPHTYCG KGVCLLTGIM
360 370 380 390 400
GAGCTALVVA VVARKLELTK AEKHVHNFMM DTQLTKRVKN AAANVLRETW
410 420 430 440 450
LIYKHTRLVK KPDQGRVRKH QRKFLQAIHQ AQKLRSVKIE QGKVNDQANT
460 470 480 490 500
LAELAKAQSI AYEVVSELQA QQEELEARLA ALESRLDVLG ASLQALPGLI
510 520 530
AQAICPLPPP WPGPGHLATA THSPQSHWLP TMGSDCG
Note: Produced by alternative splicing events in which various combinations of the four 5' non-coding exons A, B1, B2 or C are joined directly to exon 3.2.
Length:537
Mass (Da):59,330
Last modified:January 23, 2007 - v2
Checksum:iF3DCFCB9FF309A4F
GO
Isoform 2 (identifier: Q9EQR3-2) [UniParc]FASTAAdd to basket
Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFWNGQGDVQPLLSPQVHSEALLRNHAGPQRACCTPSPRRQVAM

Show »
Length:580
Mass (Da):64,066
Checksum:i7B30C8A28B349C80
GO
Isoform 3 (identifier: Q9EQR3-3) [UniParc]FASTAAdd to basket
Also known as: V

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.

Note: Reduced calmodulin-binding.
Show »
Length:500
Mass (Da):55,280
Checksum:iE258B479A7B58DB0
GO
Isoform 4 (identifier: Q9EQR3-4) [UniParc]FASTAAdd to basket
Also known as: VI

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     431-433: Missing.

Note: Reduced calmodulin-binding.
Show »
Length:497
Mass (Da):54,953
Checksum:i5BB34F1EC2247C09
GO
Isoform 5 (identifier: Q9EQR3-5) [UniParc]FASTAAdd to basket
Also known as: VII

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     423-537: KFLQAIHQAQ...WLPTMGSDCG → LRSSEV

Note: Reduced calmodulin-binding.
Show »
Length:391
Mass (Da):43,675
Checksum:i3485373BF7622FB4
GO
Isoform 6 (identifier: Q9EQR3-6) [UniParc]FASTAAdd to basket
Also known as: VIII

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     423-537: KFLQAIHQAQ...WLPTMGSDCG → SEV

Note: Reduced calmodulin-binding.
Show »
Length:388
Mass (Da):43,318
Checksum:i7C9860BFB4752E1F
GO
Isoform 7 (identifier: Q9EQR3-7) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     423-537: KFLQAIHQAQ...WLPTMGSDCG → SEV

Note: Reduced calmodulin-binding.
Show »
Length:425
Mass (Da):47,368
Checksum:i188D127F36CE9F86
GO
Isoform 8 (identifier: Q9EQR3-8) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     423-537: KFLQAIHQAQ...WLPTMGSDCG → LRSSEV

Note: Reduced calmodulin-binding.
Show »
Length:428
Mass (Da):47,725
Checksum:iCE21486FE210EF36
GO
Isoform 9 (identifier: Q9EQR3-9) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     431-433: Missing.

Show »
Length:534
Mass (Da):59,002
Checksum:i3BEBCA093D392E3F
GO

Polymorphismi

The poly-Glu region of KCNN1 is polymorphic and the number of Glu varies between strains (from 10 to 12). The repeat with 10 Glu residues (shown here) is found in BALB/c, DBA/2J, 129/SvJ, A/J, C3H/HeJ, BALB/cJ, BXD-31, SM/J, ST/BJ, FVB/NJ, NZB/B1NJ, CBA/J and CAST/Ei.1 Publication

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti66 – 661E → EE in strain: C57BL/6J, A/HeJ and SPRET/Ei. 1 Publication
Natural varianti66 – 661E → EEE in strain: SWR/J, AKR/J, RBF/DNJ and P/J.
Natural varianti522 – 5221H → Q in strain: C57BL/6J. 1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MFWNGQGDVQPLLSPQVHSE ALLRNHAGPQRACCTPSPRR QVAM in isoform 2. 1 PublicationVSP_002809
Alternative sequencei351 – 38737Missing in isoform 3, isoform 4, isoform 5 and isoform 6. CuratedVSP_002810Add
BLAST
Alternative sequencei423 – 537115KFLQA…GSDCG → LRSSEV in isoform 5 and isoform 8. CuratedVSP_002811Add
BLAST
Alternative sequencei423 – 537115KFLQA…GSDCG → SEV in isoform 6 and isoform 7. CuratedVSP_002812Add
BLAST
Alternative sequencei431 – 4333Missing in isoform 4 and isoform 9. CuratedVSP_002813

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116525 mRNA. Translation: AAG43216.1.
AF297870, AF297869 Genomic DNA. Translation: AAK30363.1.
AF303461 mRNA. Translation: AAK29550.1.
AF303462 mRNA. Translation: AAK29551.1.
AF303463 mRNA. Translation: AAK29552.1.
AF357239 mRNA. Translation: AAK48900.1.
AY258143 mRNA. Translation: AAP45948.1.
BC090622 mRNA. Translation: AAH90622.1.
RefSeqiNP_115773.2. NM_032397.2.
XP_006509870.1. XM_006509807.2.
XP_006509871.1. XM_006509808.2.
XP_011240642.1. XM_011242340.1.
XP_011240643.1. XM_011242341.1.
UniGeneiMm.32074.

Genome annotation databases

GeneIDi84036.
KEGGimmu:84036.
UCSCiuc012gfj.1. mouse. [Q9EQR3-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116525 mRNA. Translation: AAG43216.1.
AF297870, AF297869 Genomic DNA. Translation: AAK30363.1.
AF303461 mRNA. Translation: AAK29550.1.
AF303462 mRNA. Translation: AAK29551.1.
AF303463 mRNA. Translation: AAK29552.1.
AF357239 mRNA. Translation: AAK48900.1.
AY258143 mRNA. Translation: AAP45948.1.
BC090622 mRNA. Translation: AAH90622.1.
RefSeqiNP_115773.2. NM_032397.2.
XP_006509870.1. XM_006509807.2.
XP_006509871.1. XM_006509808.2.
XP_011240642.1. XM_011242340.1.
XP_011240643.1. XM_011242341.1.
UniGeneiMm.32074.

3D structure databases

ProteinModelPortaliQ9EQR3.
SMRiQ9EQR3. Positions 364-458.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-4998195.
STRINGi10090.ENSMUSP00000105705.

Protein family/group databases

TCDBi9.A.48.1.1. the unconventional protein secretion (ups) system.

Proteomic databases

MaxQBiQ9EQR3.
PaxDbiQ9EQR3.
PeptideAtlasiQ9EQR3.
PRIDEiQ9EQR3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi84036.
KEGGimmu:84036.
UCSCiuc012gfj.1. mouse. [Q9EQR3-2]

Organism-specific databases

CTDi3780.
MGIiMGI:1933993. Kcnn1.

Phylogenomic databases

eggNOGiKOG3684. Eukaryota.
ENOG410XT9D. LUCA.
HOGENOMiHOG000276908.
HOVERGENiHBG052241.
InParanoidiQ9EQR3.
KOiK04942.
PhylomeDBiQ9EQR3.

Miscellaneous databases

PROiQ9EQR3.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000002908.

Family and domain databases

InterProiIPR004178. CaM-bd_dom.
IPR015449. K_chnl_Ca-activ_SK.
IPR013099. K_chnl_dom.
[Graphical view]
PANTHERiPTHR10153. PTHR10153. 1 hit.
PfamiPF02888. CaMBD. 1 hit.
PF07885. Ion_trans_2. 1 hit.
PF03530. SK_channel. 1 hit.
[Graphical view]
PRINTSiPR01451. SKCHANNEL.
SMARTiSM01053. CaMBD. 1 hit.
[Graphical view]
SUPFAMiSSF81327. SSF81327. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiKCNN1_MOUSE
AccessioniPrimary (citable) accession number: Q9EQR3
Secondary accession number(s): Q5CZY7, Q6JXY1, Q99JA9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: January 23, 2007
Last modified: September 7, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.