Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Small conductance calcium-activated potassium channel protein 1

Gene

Kcnn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin (By similarity).By similarity

GO - Molecular functioni

Keywordsi

Molecular functionCalmodulin-binding, Ion channel
Biological processIon transport, Transport

Protein family/group databases

TCDBi9.A.48.1.1 the unconventional protein secretion (ups) system

Names & Taxonomyi

Protein namesi
Recommended name:
Small conductance calcium-activated potassium channel protein 1
Short name:
SK1
Short name:
SKCa 1
Short name:
SKCa1
Alternative name(s):
KCa2.1
Gene namesi
Name:Kcnn1
Synonyms:Sk1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1933993 Kcnn1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei108 – 128Helical; Name=Segment S1Sequence analysisAdd BLAST21
Transmembranei137 – 157Helical; Name=Segment S2Sequence analysisAdd BLAST21
Transmembranei176 – 196Helical; Name=Segment S3Sequence analysisAdd BLAST21
Transmembranei225 – 245Helical; Name=Segment S4Sequence analysisAdd BLAST21
Transmembranei274 – 294Helical; Name=Segment S5Sequence analysisAdd BLAST21
Intramembranei314 – 334Pore-forming; Name=Segment H5Sequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001550081 – 537Small conductance calcium-activated potassium channel protein 1Add BLAST537

Proteomic databases

PaxDbiQ9EQR3
PeptideAtlasiQ9EQR3
PRIDEiQ9EQR3

PTM databases

PhosphoSitePlusiQ9EQR3

Expressioni

Tissue specificityi

Highest expression in brain and liver with lower levels in heart, testis, kidney and colon. In colon, detected in smooth muscle cells. Expressed in atrial and ventricular myocytes with higher levels in atrial myocytes.2 Publications

Interactioni

Subunit structurei

Heterooligomer. The complex is composed of 4 channel subunits each of which binds to a calmodulin subunit which regulates the channel activity through calcium-binding (By similarity). Interacts with calmodulin.By similarity1 Publication

GO - Molecular functioni

  • calmodulin binding Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000105705

Structurei

3D structure databases

ProteinModelPortaliQ9EQR3
SMRiQ9EQR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni343 – 363Segment S6Sequence analysisAdd BLAST21
Regioni381 – 460Calmodulin-bindingBy similarityAdd BLAST80

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi64 – 75Poly-GluAdd BLAST12

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3684 Eukaryota
ENOG410XT9D LUCA
HOGENOMiHOG000276908
HOVERGENiHBG052241
InParanoidiQ9EQR3
KOiK04942
PhylomeDBiQ9EQR3

Family and domain databases

InterProiView protein in InterPro
IPR004178 CaM-bd_dom
IPR036122 CaM-bd_dom_sf
IPR015449 K_chnl_Ca-activ_SK
IPR013099 K_chnl_dom
PANTHERiPTHR10153 PTHR10153, 1 hit
PfamiView protein in Pfam
PF02888 CaMBD, 1 hit
PF07885 Ion_trans_2, 1 hit
PF03530 SK_channel, 1 hit
PRINTSiPR01451 SKCHANNEL
SMARTiView protein in SMART
SM01053 CaMBD, 1 hit
SUPFAMiSSF81327 SSF81327, 1 hit

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Note: At least 16 isoforms may be produced by combinatorial splicing of the N-terminal exon 3.1 and the C-terminal exons 7, 8a and 9. Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9EQR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSHSHNGSV GQPLGSGPGF LGWEPVDPEA GRPLQPTQGP GLQMVAKGQP
60 70 80 90 100
VRLSPGGSRG HPQEQEEEEE EEEEEDKTGS GKPPTVSHRL GHRRALFEKR
110 120 130 140 150
KRLSDYALIF GMFGIVVMVT ETELSWGVYT KESLCSFALK CLISLSTVIL
160 170 180 190 200
LGLVILYHAR EIQLFLVDNG ADDWRIAMTW ERVSLISLEL VVCAIHPVPG
210 220 230 240 250
HYRFTWTARL AFSLVPSAAE ADLDVLLSIP MFLRLYLLAR VMLLHSRIFT
260 270 280 290 300
DASSRSIGAL NRVTFNTRFV TKTLMTICPG TVLLVFSVSS WIVAAWTVRV
310 320 330 340 350
CERYHDKQEV TSNFLGAMWL ISITFLSIGY GDMVPHTYCG KGVCLLTGIM
360 370 380 390 400
GAGCTALVVA VVARKLELTK AEKHVHNFMM DTQLTKRVKN AAANVLRETW
410 420 430 440 450
LIYKHTRLVK KPDQGRVRKH QRKFLQAIHQ AQKLRSVKIE QGKVNDQANT
460 470 480 490 500
LAELAKAQSI AYEVVSELQA QQEELEARLA ALESRLDVLG ASLQALPGLI
510 520 530
AQAICPLPPP WPGPGHLATA THSPQSHWLP TMGSDCG
Note: Produced by alternative splicing events in which various combinations of the four 5' non-coding exons A, B1, B2 or C are joined directly to exon 3.2.
Length:537
Mass (Da):59,330
Last modified:January 23, 2007 - v2
Checksum:iF3DCFCB9FF309A4F
GO
Isoform 2 (identifier: Q9EQR3-2) [UniParc]FASTAAdd to basket
Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFWNGQGDVQPLLSPQVHSEALLRNHAGPQRACCTPSPRRQVAM

Show »
Length:580
Mass (Da):64,066
Checksum:i7B30C8A28B349C80
GO
Isoform 3 (identifier: Q9EQR3-3) [UniParc]FASTAAdd to basket
Also known as: V

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.

Note: Reduced calmodulin-binding.
Show »
Length:500
Mass (Da):55,280
Checksum:iE258B479A7B58DB0
GO
Isoform 4 (identifier: Q9EQR3-4) [UniParc]FASTAAdd to basket
Also known as: VI

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     431-433: Missing.

Note: Reduced calmodulin-binding.
Show »
Length:497
Mass (Da):54,953
Checksum:i5BB34F1EC2247C09
GO
Isoform 5 (identifier: Q9EQR3-5) [UniParc]FASTAAdd to basket
Also known as: VII

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     423-537: KFLQAIHQAQ...WLPTMGSDCG → LRSSEV

Note: Reduced calmodulin-binding.
Show »
Length:391
Mass (Da):43,675
Checksum:i3485373BF7622FB4
GO
Isoform 6 (identifier: Q9EQR3-6) [UniParc]FASTAAdd to basket
Also known as: VIII

The sequence of this isoform differs from the canonical sequence as follows:
     351-387: Missing.
     423-537: KFLQAIHQAQ...WLPTMGSDCG → SEV

Note: Reduced calmodulin-binding.
Show »
Length:388
Mass (Da):43,318
Checksum:i7C9860BFB4752E1F
GO
Isoform 7 (identifier: Q9EQR3-7) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     423-537: KFLQAIHQAQ...WLPTMGSDCG → SEV

Note: Reduced calmodulin-binding.
Show »
Length:425
Mass (Da):47,368
Checksum:i188D127F36CE9F86
GO
Isoform 8 (identifier: Q9EQR3-8) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     423-537: KFLQAIHQAQ...WLPTMGSDCG → LRSSEV

Note: Reduced calmodulin-binding.
Show »
Length:428
Mass (Da):47,725
Checksum:iCE21486FE210EF36
GO
Isoform 9 (identifier: Q9EQR3-9) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     431-433: Missing.

Show »
Length:534
Mass (Da):59,002
Checksum:i3BEBCA093D392E3F
GO

Polymorphismi

The poly-Glu region of KCNN1 is polymorphic and the number of Glu varies between strains (from 10 to 12). The repeat with 10 Glu residues (shown here) is found in BALB/c, DBA/2J, 129/SvJ, A/J, C3H/HeJ, BALB/cJ, BXD-31, SM/J, ST/BJ, FVB/NJ, NZB/B1NJ, CBA/J and CAST/Ei.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti66E → EE in strain: C57BL/6J, A/HeJ and SPRET/Ei. 1 Publication1
Natural varianti66E → EEE in strain: SWR/J, AKR/J, RBF/DNJ and P/J. 1
Natural varianti522H → Q in strain: C57BL/6J. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0028091M → MFWNGQGDVQPLLSPQVHSE ALLRNHAGPQRACCTPSPRR QVAM in isoform 2. 1 Publication1
Alternative sequenceiVSP_002810351 – 387Missing in isoform 3, isoform 4, isoform 5 and isoform 6. CuratedAdd BLAST37
Alternative sequenceiVSP_002811423 – 537KFLQA…GSDCG → LRSSEV in isoform 5 and isoform 8. CuratedAdd BLAST115
Alternative sequenceiVSP_002812423 – 537KFLQA…GSDCG → SEV in isoform 6 and isoform 7. CuratedAdd BLAST115
Alternative sequenceiVSP_002813431 – 433Missing in isoform 4 and isoform 9. Curated3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116525 mRNA Translation: AAG43216.1
AF297870, AF297869 Genomic DNA Translation: AAK30363.1
AF303461 mRNA Translation: AAK29550.1
AF303462 mRNA Translation: AAK29551.1
AF303463 mRNA Translation: AAK29552.1
AF357239 mRNA Translation: AAK48900.1
AY258143 mRNA Translation: AAP45948.1
BC090622 mRNA Translation: AAH90622.1
RefSeqiNP_115773.2, NM_032397.2
XP_006509870.1, XM_006509807.3
XP_006509871.1, XM_006509808.3
UniGeneiMm.32074

Genome annotation databases

GeneIDi84036
KEGGimmu:84036
UCSCiuc012gfj.1 mouse [Q9EQR3-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiKCNN1_MOUSE
AccessioniPrimary (citable) accession number: Q9EQR3
Secondary accession number(s): Q5CZY7, Q6JXY1, Q99JA9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: January 23, 2007
Last modified: February 28, 2018
This is version 140 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health