Reviewed,
UniProtKB/Swiss-Prot Q9EQQ9 (NCOAT_MOUSE)
Last modified
June 16, 2009.
Version 51.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bifunctional protein NCOAT Alternative name(s): Nuclear cytoplasmic O-GlcNAcase and acetyltransferase Meningioma-expressed antigen 5 Including the following 2 domains: 1- Recommended name: Beta-hexosaminidase EC=3.2.1.52 Alternative name(s): N-acetyl-beta-glucosaminidase Beta-N-acetylhexosaminidase Hexosaminidase C N-acetyl-beta-D-glucosaminidase O-GlcNAcase 2- Recommended name: Histone acetyltransferase Short name=HAT EC=2.3.1.48 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 916 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity By similarity. Acetylates 'Lys-8' of histone H4. |
| Catalytic activity | Hydrolysis of terminal non-reducing N-acetyl-D-hexosamine residues in N-acetyl-beta-D-hexosaminides. Acetyl-CoA + histone = CoA + acetylhistone. |
| Subunit structure | Monomer By similarity. Binds both acetylated and unacetylated histone H4 tail but acetylation on 'Lys-8' of histone H4 abolishes binding. |
| Subcellular location | |
| Developmental stage | Expressed throughout development from blastocyst stage to embryonic day 16.5. Ref.7 |
| Post-translational modification | Proteolytically cleaved by caspase-3 By similarity. |
| biophysicochemical properties | Kinetic parameters: KM=0.49 mM for pNP-GLcNAc pH dependence: Optimum pH is 6.5-7. |
| Sequence caution | The sequence AAH41109.1 differs from that shown. Reason: Miscellaneous discrepancy. Contaminating sequence. Potential poly-A sequence. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Acyltransferase Glycosidase Hydrolase Transferase |
| PTM | Disulfide bond Phosphoprotein |
| Technical term | Direct protein sequencing Multifunctional enzyme |
| Gene Ontology (GO) | |
| Biological process | metabolic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | beta-N-acetylhexosaminidase activity Inferred from electronic annotation. Source: EC histone acetyltransferase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9EQQ9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9EQQ9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-698: Missing. 699-725: NDLFFQPPPLTPTSKVYTIRPYFPKDE → MYTTHSCLYSFFLTFFLVCCLTRLYFQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9EQQ9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVRPRVWRSSRRVASQNGLRAFGPTDRGRRGAVAGGRRM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 916 | 916 | Bifunctional protein NCOAT | PRO_0000252119 | |||||||
Regions | |||||||||||
| Region | 583 – 916 | 334 | Histone acetyltransferase activity By similarity | ||||||||
| Region | 695 – 814 | 120 | Required for histone H4 binding | ||||||||
Sites | |||||||||||
| Active site | 175 | 1 | Nucleophile; for O-GlcNAcase activity Ref.9 | ||||||||
| Active site | 177 | 1 | Proton donor; for O-GlcNAcase activity Ref.9 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 364 | 1 | Phosphoserine Ref.8 Ref.10 | ||||||||
| Disulfide bond | 777 ↔ 793 | Ref.6 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 698 | 698 | Missing in isoform 2. | VSP_020870 | |||||||
| Alternative sequence | 1 | 1 | M → MVRPRVWRSSRRVASQNGLR AFGPTDRGRRGAVAGGRRM in isoform 3. | VSP_020871 | |||||||
| Alternative sequence | 699 – 725 | 27 | NDLFF…FPKDE → MYTTHSCLYSFFLTFFLVCC LTRLYFQ in isoform 2. | VSP_020872 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 166 | 1 | C → S: No change in substrate affinity but 60% reduction in O-GlcNAcase activity. Ref.9 | ||||||||
| Mutagenesis | 174 | 1 | D → N: 2-fold increase in substrate affinity and 77% reduction in O-GlcNAcase activity. Regains appreciable level of catalytic efficiency in the acidic pH range. No recovery of activity in the presence of sodium azide. Ref.9 | ||||||||
| Mutagenesis | 175 | 1 | D → A: 3-fold increase in substrate affinity and 90% reduction in O-GlcNAcase activity. Regains appreciable level of catalytic efficiency in the acidic pH range. 70% recovery of activity in the presence of sodium azide. Ref.9 | ||||||||
| Mutagenesis | 177 | 1 | D → N: 2-fold decrease in substrate affinity and 96% reduction in O-GlcNAcase activity. Regains appreciable level of catalytic efficiency in the acidic pH range. 40% recovery of activity in the presence of sodium azide. Ref.9 | ||||||||
| Mutagenesis | 774 | 1 | D → A: Disrupts ability to bind histone H4 as well as HAT activity. Ref.6 | ||||||||
| Mutagenesis | 777 | 1 | C → A: Disrupts ability to bind histone H4 as well as HAT activity. Ref.6 | ||||||||
| Mutagenesis | 789 | 1 | F → A: Disrupts ability to bind histone H4 as well as HAT activity. Ref.6 | ||||||||
| Mutagenesis | 793 | 1 | C → A: Disrupts ability to bind histone H4 as well as HAT activity. Ref.6 | ||||||||
| Mutagenesis | 796 | 1 | S → A: Disrupts ability to bind histone H4 as well as HAT activity. Ref.6 | ||||||||
| Mutagenesis | 853 | 1 | D → N: Retains ability to bind histone H4. Ref.6 | ||||||||
| Mutagenesis | 878 | 1 | C → S: No effect on O-GlcNAcase activity. Ref.9 | ||||||||
| Mutagenesis | 884 | 1 | D → N: Retains ability to bind histone H4. Ref.6 | ||||||||
| Mutagenesis | 891 | 1 | Y → F: Retains ability to bind histone H4. Ref.6 | ||||||||
| Sequence conflict | 6 | 1 | S → T in BAE26311. Ref.3 | ||||||||
| Sequence conflict | 52 – 53 | 2 | GA → RT in BAE26311. Ref.3 | ||||||||
| Sequence conflict | 742 | 1 | F → S in BAC97998. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mgea5, the murine homolog of a neutral-active cytosolic beta-N-acetylglucosaminidase, localized on chromosome 19." Csoka A.B. Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H. DNA Res. 10:167-180(2003) [PubMed: 14621295] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryonic tail. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-603 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-77 (ISOFORM 3). Strain: C57BL/6J and NOD. Tissue: Head, Mammary gland and Thymus. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N-3. Tissue: Kidney and Mammary tumor. |
| [5] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 109-127, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [6] | "The histone acetyltransferase NCOAT contains a zinc finger-like motif involved in substrate recognition." Toleman C.A., Paterson A.J., Kudlow J.E. J. Biol. Chem. 281:3918-3925(2006) [PubMed: 16356930] [Abstract] Cited for: PROTEIN SEQUENCE OF 157-167; 775-785 AND 875-886, FUNCTION, SUBUNIT, DISULFIDE BOND, MUTAGENESIS OF ASP-774; CYS-777; PHE-789; CYS-793; SER-796; ASP-853; ASP-884 AND TYR-891. |
| [7] | "Identification of a nuclear variant of MGEA5, a cytoplasmic hyaluronidase and a beta-N-acetylglucosaminidase." Comtesse N., Maldener E., Meese E. Biochem. Biophys. Res. Commun. 283:634-640(2001) [PubMed: 11341771] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [8] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed: 15345747] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-364, MASS SPECTROMETRY. Tissue: Brain. |
| [9] | "Location and characterization of the O-GlcNAcase active site." Toleman C., Paterson A.J., Kudlow J.E. Biochim. Biophys. Acta 1760:829-839(2006) [PubMed: 16517082] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, ACTIVE SITE, BIOPHYSICOCHEMICAL PROPERTIES, MUTAGENESIS OF CYS-166; ASP-174; ASP-175; ASP-177 AND CYS-878. |
| [10] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed: 17242355] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-364, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF132214 mRNA. Translation: AAG43273.2. AK129188 mRNA. Translation: BAC97998.1. Different initiation. BC041109 mRNA. Translation: AAH41109.1. Sequence problems. BC054821 mRNA. Translation: AAH54821.1. AK012695 mRNA. Translation: BAB28416.1. AK014781 mRNA. Translation: BAB29550.1. AK077613 mRNA. Translation: BAC36900.1. AK088774 mRNA. Translation: BAC40564.1. AK145227 mRNA. Translation: BAE26311.1. Different initiation. | |
| IPI | IPI00406624. IPI00655175. IPI00788404. |
| RefSeq | NP_076288.1. |
| UniGene | Mm.122725 Mm.393213 Mm.440640 |
3D structure databases | |
| ModBase | Search... |
Protein family/group databases | |
| CAZy | GH84. Glycoside Hydrolase Family 84. |
PTM databases | |
| PhosphoSite | Q9EQQ9. |
Proteomic databases | |
| PRIDE | Q9EQQ9. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000025220. Mus musculus. [Contig view] |
| GeneID | 76055. |
| KEGG | mmu:76055. |
| NMPDR | fig|10090.3.peg.5165. |
Organism-specific databases | |
| MGI | MGI:1932139. Mgea5. |
| Rouge | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9EQQ9. |
| OMA | Q9EQQ9. SMVKSFV. |
Enzyme and pathway databases | |
| BRENDA | 2.3.1.48. 244. 3.2.1.52. 244. |
Gene expression databases | |
| ArrayExpress | Q9EQQ9. |
| Bgee | Q9EQQ9. |
| CleanEx | MM_MGEA5. |
| GermOnline | ENSMUSG00000025220. Mus musculus. |
Family and domain databases | |
| InterPro | IPR016181. Acyl_CoA_acyltransferase. IPR011496. Beta-N-acetylglucosaminidase. [Graphical view] |
| Gene3D | G3DSA:3.40.630.30. Acyl_CoA_acyltransferase. 1 hit. |
| Pfam | PF07555. NAGidase. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 344519. |
| SOURCE | Search... |
Entry information
| Entry name | NCOAT_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9EQQ9 Secondary accession number(s): Q3ULY7 Q9CUR7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |

Clusters with


