Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9EPR2

- PG12A_MOUSE

UniProt

Q9EPR2 - PG12A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Group XIIA secretory phospholipase A2

Gene

Pla2g12a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine (By similarity).By similarity

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.PROSITE-ProRule annotation

Cofactori

Ca2+By similarityNote: Binds 1 Ca(2+) ion per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi91 – 911Calcium; via carbonyl oxygenBy similarity
Metal bindingi93 – 931Calcium; via carbonyl oxygenBy similarity
Metal bindingi95 – 951Calcium; via carbonyl oxygenBy similarity
Active sitei113 – 1131PROSITE-ProRule annotation
Metal bindingi114 – 1141CalciumBy similarity
Active sitei128 – 1281PROSITE-ProRule annotation

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. phospholipase A2 activity Source: MGI

GO - Biological processi

  1. lipid catabolic process Source: MGI
  2. phospholipid metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_188640. Synthesis of PA.
REACT_199024. Acyl chain remodelling of PI.
REACT_199027. Acyl chain remodelling of PE.
REACT_199030. Acyl chain remodelling of PS.
REACT_199038. Acyl chain remodelling of PC.
REACT_199039. Acyl chain remodelling of PG.

Names & Taxonomyi

Protein namesi
Recommended name:
Group XIIA secretory phospholipase A2 (EC:3.1.1.4)
Short name:
GXII sPLA2
Short name:
sPLA2-XII
Alternative name(s):
Phosphatidylcholine 2-acylhydrolase 12A
Gene namesi
Name:Pla2g12a
Synonyms:Pla2g12
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 3

Organism-specific databases

MGIiMGI:1913600. Pla2g12a.

Subcellular locationi

Secreted. Cytoplasm By similarity

GO - Cellular componenti

  1. endoplasmic reticulum Source: MGI
  2. extracellular region Source: UniProtKB-KW
  3. Golgi apparatus Source: MGI
  4. intracellular Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 192167Group XIIA secretory phospholipase A2PRO_0000022771Add
BLAST

Proteomic databases

PaxDbiQ9EPR2.
PRIDEiQ9EPR2.

PTM databases

PhosphoSiteiQ9EPR2.

Expressioni

Gene expression databases

BgeeiQ9EPR2.
CleanExiMM_PLA2G12A.
GenevestigatoriQ9EPR2.

Structurei

3D structure databases

ProteinModelPortaliQ9EPR2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the phospholipase A2 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG68062.
GeneTreeiENSGT00390000008798.
HOGENOMiHOG000247019.
HOVERGENiHBG053577.
InParanoidiQ9EPR2.
KOiK01047.
OMAiKICRNVQ.
OrthoDBiEOG7J1818.
PhylomeDBiQ9EPR2.
TreeFamiTF323302.

Family and domain databases

Gene3Di1.20.90.10. 1 hit.
InterProiIPR013090. PLipase_A2_AS.
IPR016090. PLipase_A2_dom.
IPR010711. PLipase_A2_secretory_G12.
[Graphical view]
PANTHERiPTHR12824. PTHR12824. 1 hit.
PfamiPF06951. PLA2G12. 1 hit.
[Graphical view]
SUPFAMiSSF48619. SSF48619. 1 hit.
PROSITEiPS00118. PA2_HIS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9EPR2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVTPRPAPAR SPALLLLLLL ATARGQEQDQ TTDWRATLKT IRNGIHKIDT
60 70 80 90 100
YLNAALDLLG GEDGLCQYKC SDGSKPVPRY GYKPSPPNGC GSPLFGVHLN
110 120 130 140 150
IGIPSLTKCC NQHDRCYETC GKSKNDCDEE FQYCLSKICR DVQKTLGLSQ
160 170 180 190
NVQACETTVE LLFDSVIHLG CKPYLDSQRA ACWCRYEEKT DL
Length:192
Mass (Da):21,319
Last modified:April 16, 2002 - v2
Checksum:i670ACE8F6AB6FCA2
GO
Isoform 2 (identifier: Q9EPR2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MVTPRPAPAR...GLCQYKCSDG → MKDYHSGPGKYWEPFAFPVGCSGTEEEEGLRIGR

Show »
Length:153
Mass (Da):17,199
Checksum:iC9021DB502233080
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti11 – 111S → G in AAG23336. (PubMed:11278438)Curated
Sequence conflicti173 – 1731P → H in BAB26094. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7373MVTPR…KCSDG → MKDYHSGPGKYWEPFAFPVG CSGTEEEEGLRIGR in isoform 2. CuratedVSP_004509Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007381 mRNA. Translation: AAG23336.1.
AY007382 mRNA. Translation: AAG23337.1.
AK003183 mRNA. No translation available.
AK009133 mRNA. Translation: BAB26094.1.
AK010011 mRNA. Translation: BAB26641.1.
AK010174 mRNA. Translation: BAB26747.1.
AK163693 mRNA. Translation: BAE37460.1.
BC051117 mRNA. Translation: AAH51117.1.
CCDSiCCDS17836.1. [Q9EPR2-1]
CCDS17837.1. [Q9EPR2-2]
RefSeqiNP_075685.2. NM_023196.4. [Q9EPR2-1]
NP_904359.1. NM_183423.3. [Q9EPR2-2]
UniGeneiMm.151951.

Genome annotation databases

EnsembliENSMUST00000029629; ENSMUSP00000029629; ENSMUSG00000027999. [Q9EPR2-1]
ENSMUST00000061165; ENSMUSP00000053651; ENSMUSG00000027999. [Q9EPR2-2]
GeneIDi66350.
KEGGimmu:66350.
UCSCiuc008rip.2. mouse. [Q9EPR2-2]
uc012cxt.1. mouse. [Q9EPR2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007381 mRNA. Translation: AAG23336.1 .
AY007382 mRNA. Translation: AAG23337.1 .
AK003183 mRNA. No translation available.
AK009133 mRNA. Translation: BAB26094.1 .
AK010011 mRNA. Translation: BAB26641.1 .
AK010174 mRNA. Translation: BAB26747.1 .
AK163693 mRNA. Translation: BAE37460.1 .
BC051117 mRNA. Translation: AAH51117.1 .
CCDSi CCDS17836.1. [Q9EPR2-1 ]
CCDS17837.1. [Q9EPR2-2 ]
RefSeqi NP_075685.2. NM_023196.4. [Q9EPR2-1 ]
NP_904359.1. NM_183423.3. [Q9EPR2-2 ]
UniGenei Mm.151951.

3D structure databases

ProteinModelPortali Q9EPR2.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q9EPR2.

Proteomic databases

PaxDbi Q9EPR2.
PRIDEi Q9EPR2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000029629 ; ENSMUSP00000029629 ; ENSMUSG00000027999 . [Q9EPR2-1 ]
ENSMUST00000061165 ; ENSMUSP00000053651 ; ENSMUSG00000027999 . [Q9EPR2-2 ]
GeneIDi 66350.
KEGGi mmu:66350.
UCSCi uc008rip.2. mouse. [Q9EPR2-2 ]
uc012cxt.1. mouse. [Q9EPR2-1 ]

Organism-specific databases

CTDi 81579.
MGIi MGI:1913600. Pla2g12a.

Phylogenomic databases

eggNOGi NOG68062.
GeneTreei ENSGT00390000008798.
HOGENOMi HOG000247019.
HOVERGENi HBG053577.
InParanoidi Q9EPR2.
KOi K01047.
OMAi KICRNVQ.
OrthoDBi EOG7J1818.
PhylomeDBi Q9EPR2.
TreeFami TF323302.

Enzyme and pathway databases

Reactomei REACT_188640. Synthesis of PA.
REACT_199024. Acyl chain remodelling of PI.
REACT_199027. Acyl chain remodelling of PE.
REACT_199030. Acyl chain remodelling of PS.
REACT_199038. Acyl chain remodelling of PC.
REACT_199039. Acyl chain remodelling of PG.

Miscellaneous databases

NextBioi 321399.
PROi Q9EPR2.
SOURCEi Search...

Gene expression databases

Bgeei Q9EPR2.
CleanExi MM_PLA2G12A.
Genevestigatori Q9EPR2.

Family and domain databases

Gene3Di 1.20.90.10. 1 hit.
InterProi IPR013090. PLipase_A2_AS.
IPR016090. PLipase_A2_dom.
IPR010711. PLipase_A2_secretory_G12.
[Graphical view ]
PANTHERi PTHR12824. PTHR12824. 1 hit.
Pfami PF06951. PLA2G12. 1 hit.
[Graphical view ]
SUPFAMi SSF48619. SSF48619. 1 hit.
PROSITEi PS00118. PA2_HIS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel group of phospholipase A2s preferentially expressed in type 2 helper T cells."
    Ho I.C., Arm J.P., Bingham C.O. III, Choi A., Austen K.F., Glimcher L.H.
    J. Biol. Chem. 276:18321-18326(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Strain: AKR.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Cerebellum, Embryo and Tongue.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Olfactory epithelium.

Entry informationi

Entry nameiPG12A_MOUSE
AccessioniPrimary (citable) accession number: Q9EPR2
Secondary accession number(s): Q3TQC4
, Q9CQR3, Q9CTL1, Q9D7L3, Q9EPR1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 16, 2002
Last sequence update: April 16, 2002
Last modified: November 26, 2014
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3