Q9EPR2 (PG12A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Group XIIA secretory phospholipase A2 Short name=GXII sPLA2 Short name=sPLA2-XII EC=3.1.1.4 Alternative name(s): Phosphatidylcholine 2-acylhydrolase 12A | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 192 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine By similarity. |
| Catalytic activity | Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate. |
| Cofactor | Binds 1 calcium ion per subunit By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the phospholipase A2 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation Lipid metabolism |
| Cellular component | Cytoplasm Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Ligand | Calcium Metal-binding |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | lipid catabolic process Inferred by curator Ref.1. Source: MGI phospholipid metabolic processInferred from electronic annotation. Source: InterPro |
| Cellular_component | Golgi apparatus Inferred from direct assay Ref.1. Source: MGI endoplasmic reticulumInferred from direct assay Ref.1. Source: MGI extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro phospholipase A2 activityInferred from direct assay Ref.1. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9EPR2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9EPR2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MVTPRPAPAR...GLCQYKCSDG → MKDYHSGPGKYWEPFAFPVGCSGTEEEEGLRIGR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||
| Chain | 26 – 192 | 167 | Group XIIA secretory phospholipase A2 | PRO_0000022771 | |||||
Sites | |||||||||
| Active site | 113 | 1 | By similarity | ||||||
| Active site | 128 | 1 | By similarity | ||||||
| Metal binding | 91 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 93 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 95 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 114 | 1 | Calcium By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 73 | 73 | MVTPR…KCSDG → MKDYHSGPGKYWEPFAFPVG CSGTEEEEGLRIGR in isoform 2. | VSP_004509 | |||||
Experimental info | |||||||||
| Sequence conflict | 11 | 1 | S → G in AAG23336. Ref.1 | ||||||
| Sequence conflict | 173 | 1 | P → H in BAB26094. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY007381 mRNA. Translation: AAG23336.1. AY007382 mRNA. Translation: AAG23337.1. AK003183 mRNA. No translation available. AK009133 mRNA. Translation: BAB26094.1. AK010011 mRNA. Translation: BAB26641.1. AK010174 mRNA. Translation: BAB26747.1. AK163693 mRNA. Translation: BAE37460.1. BC051117 mRNA. Translation: AAH51117.1. |
| IPI | IPI00110259. IPI00230716. |
| RefSeq | NP_075685.2. NM_023196.3. NP_904359.1. NM_183423.2. |
| UniGene | Mm.151951. |
3D structure databases | |
| ProteinModelPortal | Q9EPR2. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9EPR2. |
Proteomic databases | |
| PaxDb | Q9EPR2. |
| PRIDE | Q9EPR2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000029629; ENSMUSP00000029629; ENSMUSG00000027999. ENSMUST00000061165; ENSMUSP00000053651; ENSMUSG00000027999. |
| GeneID | 66350. |
| KEGG | mmu:66350. |
| UCSC | uc008rip.2. mouse. uc012cxt.1. mouse. |
Organism-specific databases | |
| CTD | 81579. |
| MGI | MGI:1913600. Pla2g12a. |
Phylogenomic databases | |
| eggNOG | NOG68062. |
| GeneTree | ENSGT00390000008798. |
| HOGENOM | HOG000247019. |
| HOVERGEN | HBG053577. |
| InParanoid | Q9EPR2. |
| KO | K01047. |
| OMA | MHLGCKP. |
| OrthoDB | EOG4MPHR9. |
Gene expression databases | |
| Bgee | Q9EPR2. |
| CleanEx | MM_PLA2G12A. |
| Genevestigator | Q9EPR2. |
| GermOnline | ENSMUSG00000027999. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.20.90.10. 1 hit. |
| InterPro | IPR013090. PLipase_A2_AS. IPR016090. PLipase_A2_dom. IPR010711. PLipase_A2_secretory_G12. [Graphical view] |
| PANTHER | PTHR12824. PTHR12824. 1 hit. |
| Pfam | PF06951. PLA2G12. 1 hit. [Graphical view] |
| SUPFAM | SSF48619. PhospholipaseA2. 1 hit. |
| PROSITE | PS00119. PA2_ASP. False negative. PS00118. PA2_HIS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 321399. |
| SOURCE | Search... |
Entry information
| Entry name | PG12A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9EPR2 Secondary accession number(s): Q3TQC4 Q9EPR1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
