Reviewed,
UniProtKB/Swiss-Prot Q9EPK5 (WWTR1_MOUSE)
Last modified
February 9, 2010.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: WW domain-containing transcription regulator protein 1 Alternative name(s): Transcriptional coactivator with PDZ-binding motif | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 395 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Functions as a transcriptional coactivator. Ref.1 |
| Subunit structure | Binds to SLC9A3R2 via the PDZ motif at the plasma membrane. Binds to YWHAZ in vivo and in vitro through the phosphoserine-binding motif RSHSSP. Ref.1 |
| Subcellular location | Nucleus. Cytoplasm. Note: Concentrates along specific portions of the plasma membrane, and accumulates in punctate nuclear bodies. When phosphorylated is retained in cytoplasm by YWHAZ. Ref.1 |
| Tissue specificity | Highly expressed in kidney, heart, placenta and lung. Ref.1 |
| Domain | The PDZ-binding motif is essential for stimulated gene transcription. It localizes the protein into both punctate nuclear foci and plasma membrane-associated complexes. Binds to transcription factors via its WW domain. |
| Post-translational modification | Phosphorylated. Phosphorylation results in the inhibition of transcriptional coactivation through YWHAZ-mediated nuclear export. Ref.1 Ref.4 |
| Sequence similarities | Contains 1 WW domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 1 | EBI-1211920,EBI-1211920 | ||
| Crebbp | P45481 | 1 | EBI-1211920,EBI-296306 | |
| KAT2B | Q92831 | 1 | EBI-1211920,EBI-477430 | From a different organism. |
| Nkx2-1 | P23441 | 1 | EBI-1211920,EBI-1223127 | From a different organism. |
| TBX5 | Q99593 | 1 | EBI-1211920,EBI-297043 | From a different organism. |
| Yap1 | P46938 | 1 | EBI-1211920,EBI-1211949 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9EPK5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9EPK5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHNSTAPLSARLFPKGGSLLQTLFMGQSGSRGGCARLRLLCRLLAQWERPRPVPGIKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 395 | 395 | WW domain-containing transcription regulator protein 1 | PRO_0000076070 | |||||
Regions | |||||||||
| Domain | 124 – 157 | 34 | WW | ||||||
| Coiled coil | 224 – 258 | 35 | Potential | ||||||
| Motif | 389 – 395 | 7 | PDZ-binding By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 87 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 89 | 1 | Phosphoserine Ref.1 | ||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MHNSTAPLSARLFPKGGSLL QTLFMGQSGSRGGCARLRLL CRLLAQWERPRPVPGIKM in isoform 2. | VSP_026137 | |||||
Experimental info | |||||||||
| Mutagenesis | 89 | 1 | S → A: Loss of YWHAZ binding with increased nuclear localization. Partial recovery of nuclear accumulation; when associated with deletion of 392-L--L-395. Ref.1 | ||||||
| Mutagenesis | 392 – 395 | 4 | Missing: Loss of SLC9A3R2 binding and reduced nuclear localization. Partial recovery of nuclear accumulation; when associated with A-89. Ref.1 | ||||||
| Sequence conflict | 384 | 1 | A → V in CAC17733. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins." Kanai F., Marignani P.A., Sarbassova D., Yagi R., Hall R.A., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley L.C., Yaffe M.B. EMBO J. 19:6778-6791(2000) [PubMed: 11118213] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SLC9A3R2 AND YWHAZ, PHOSPHORYLATION AT SER-89, TISSUE SPECIFICITY, MUTAGENESIS OF SER-89 AND 392-GLU--LEU-395. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Heart. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Mammary tumor. |
| [4] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed: 17242355] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-93, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ299430 mRNA. Translation: CAC17733.1. AK142299 mRNA. Translation: BAE25019.1. AK142720 mRNA. Translation: BAE25174.1. BC004640 mRNA. Translation: AAH04640.1. BC014727 mRNA. Translation: AAH14727.1. |
| IPI | IPI00320121. IPI00848891. |
| RefSeq | NP_001161753.1. NP_598545.2. |
| UniGene | Mm.405029 |
3D structure databases | |
| SMR | Q9EPK5. Positions 118-157. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9EPK5. 7 interactions. |
| STRING | Q9EPK5. |
PTM databases | |
| PhosphoSite | Q9EPK5. |
Genome annotation databases | |
| Ensembl | ENSMUST00000029380; ENSMUSP00000029380; ENSMUSG00000027803; Mus musculus. [Genome view] ENSMUST00000120977; ENSMUSP00000113040; ENSMUSG00000027803; Mus musculus. [Genome view] |
| GeneID | 97064. |
| KEGG | mmu:97064. |
| UCSC | uc008phb.1. mouse. |
Organism-specific databases | |
| CTD | 97064. |
| MGI | MGI:1917649. Wwtr1. |
Phylogenomic databases | |
| eggNOG | roNOG10463. |
| HOGENOM | HBG714081. |
| HOVERGEN | Q9EPK5. |
| InParanoid | Q9EPK5. |
| OMA | AMSQPNL. |
| OrthoDB | EOG98GZPF. |
| PhylomeDB | Q9EPK5. |
Gene expression databases | |
| ArrayExpress | Q9EPK5. |
| Bgee | Q9EPK5. |
| CleanEx | MM_WWTR1. |
| Genevestigator | Q9EPK5. |
| GermOnline | ENSMUSG00000027803. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001202. WW_Rsp5_WWP. [Graphical view] |
| Pfam | PF00397. WW. 1 hit. [Graphical view] |
| SMART | SM00456. WW. 1 hit. [Graphical view] |
| PROSITE | PS01159. WW_DOMAIN_1. 1 hit. PS50020. WW_DOMAIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 352477. |
| SOURCE | Search... |
Entry information
| Entry name | WWTR1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9EPK5 Secondary accession number(s): Q3UQ69, Q3UQM0, Q99KI4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


