Q9EPK5 (WWTR1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: WW domain-containing transcription regulator protein 1 Alternative name(s): Transcriptional coactivator with PDZ-binding motif | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 395 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. Regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition By similarity. Ref.1 |
| Subunit structure | Binds to SLC9A3R2 via the PDZ motif at the plasma membrane. Binds to YWHAZ in vivo and in vitro through the phosphoserine-binding motif RSHSSP. Interacts (via coiled-coil domain) with SMAD2 (via MH1 domain), SMAD3 and SMAD4. Interacts with MED15, PAX8 and NKX2-1. Interacts with TEAD1, TEAD2, TEAD3 and TEAD4 By similarity. Ref.1 |
| Subcellular location | Nucleus. Cytoplasm. Note: Concentrates along specific portions of the plasma membrane, and accumulates in punctate nuclear bodies. When phosphorylated is retained in cytoplasm by YWHAZ. Can be retained in the nucleus by MED15 By similarity. Ref.1 |
| Tissue specificity | Highly expressed in kidney, heart, placenta and lung. Ref.1 |
| Domain | The PDZ-binding motif is essential for stimulated gene transcription. It localizes the protein into both punctate nuclear foci and plasma membrane-associated complexes. Binds to transcription factors via its WW domain. |
| Post-translational modification | Phosphorylated by LATS2 and STK3/MST2. Phosphorylation by LATS2 results in creation of 14-3-3 binding sites, retention in the cytoplasm, and functional inactivation By similarity. Phosphorylation results in the inhibition of transcriptional coactivation through YWHAZ-mediated nuclear export. Ref.1 |
| Sequence similarities | Contains 1 WW domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CCAR1 | Q8IX12 | 5 | EBI-1211920,EBI-356265 | From a different organism. |
| CTNNB1 | P35222 | 2 | EBI-1211920,EBI-491549 | From a different organism. |
| Nkx2-1 | P23441 | 3 | EBI-1211920,EBI-1223127 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9EPK5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9EPK5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHNSTAPLSARLFPKGGSLLQTLFMGQSGSRGGCARLRLLCRLLAQWERPRPVPGIKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 395 | 395 | WW domain-containing transcription regulator protein 1 | PRO_0000076070 | |||||
Regions | |||||||||
| Domain | 124 – 157 | 34 | WW | ||||||
| Coiled coil | 224 – 258 | 35 | Potential | ||||||
| Motif | 389 – 395 | 7 | PDZ-binding By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 89 | 1 | Phosphoserine; by LATS2 By similarity | ||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 306 | 1 | Phosphoserine; by LATS2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MHNSTAPLSARLFPKGGSLL QTLFMGQSGSRGGCARLRLL CRLLAQWERPRPVPGIKM in isoform 2. | VSP_026137 | |||||
Experimental info | |||||||||
| Mutagenesis | 89 | 1 | S → A: Loss of YWHAZ binding with increased nuclear localization. Partial recovery of nuclear accumulation; when associated with deletion of 392-L--L-395. Ref.1 | ||||||
| Mutagenesis | 392 – 395 | 4 | Missing: Loss of SLC9A3R2 binding and reduced nuclear localization. Partial recovery of nuclear accumulation; when associated with A-89. Ref.1 | ||||||
| Sequence conflict | 384 | 1 | A → V in CAC17733. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins." Kanai F., Marignani P.A., Sarbassova D., Yagi R., Hall R.A., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley L.C., Yaffe M.B. EMBO J. 19:6778-6791(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SLC9A3R2 AND YWHAZ, PHOSPHORYLATION AT SER-89, TISSUE SPECIFICITY, MUTAGENESIS OF SER-89 AND 392-GLU--LEU-395. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Heart. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: FVB/N. Tissue: Mammary tumor. |
| [4] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-93, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ299430 mRNA. Translation: CAC17733.1. AK142299 mRNA. Translation: BAE25019.1. AK142720 mRNA. Translation: BAE25174.1. BC004640 mRNA. Translation: AAH04640.1. BC014727 mRNA. Translation: AAH14727.1. |
| IPI | IPI00320121. IPI00848891. |
| RefSeq | NP_001161753.1. NM_001168281.1. NP_598545.2. NM_133784.3. |
| UniGene | Mm.405029. |
3D structure databases | |
| ProteinModelPortal | Q9EPK5. |
| SMR | Q9EPK5. Positions 14-57, 123-157. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9EPK5. 9 interactions. |
| MINT | MINT-4123841. |
PTM databases | |
| PhosphoSite | Q9EPK5. |
Proteomic databases | |
| PaxDb | Q9EPK5. |
| PRIDE | Q9EPK5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000029380; ENSMUSP00000029380; ENSMUSG00000027803. ENSMUST00000120977; ENSMUSP00000113040; ENSMUSG00000027803. |
| GeneID | 97064. |
| KEGG | mmu:97064. |
| UCSC | uc008phb.2. mouse. uc012cpt.1. mouse. |
Organism-specific databases | |
| CTD | 25937. |
| MGI | MGI:1917649. Wwtr1. |
Phylogenomic databases | |
| eggNOG | NOG247722. |
| GeneTree | ENSGT00510000046760. |
| HOGENOM | HOG000007854. |
| HOVERGEN | HBG002748. |
| InParanoid | Q9EPK5. |
| KO | K16820. |
| OMA | MAMSQPN. |
| OrthoDB | EOG4MSCZC. |
Enzyme and pathway databases | |
| Reactome | REACT_78136. Gene Expression. |
Gene expression databases | |
| Bgee | Q9EPK5. |
| CleanEx | MM_WWTR1. |
| Genevestigator | Q9EPK5. |
| GermOnline | ENSMUSG00000027803. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001202. WW_dom. [Graphical view] |
| Pfam | PF00397. WW. 1 hit. [Graphical view] |
| SMART | SM00456. WW. 1 hit. [Graphical view] |
| SUPFAM | SSF51045. WW_Rsp5_WWP. 1 hit. |
| PROSITE | PS01159. WW_DOMAIN_1. 1 hit. PS50020. WW_DOMAIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 352477. |
| SOURCE | Search... |
Entry information
| Entry name | WWTR1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9EPK5 Secondary accession number(s): Q3UQ69, Q3UQM0, Q99KI4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
