Q9EPF2 (MUC18_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cell surface glycoprotein MUC18 Alternative name(s): Gicerin Melanoma cell adhesion molecule Melanoma-associated antigen MUC18 CD_antigen=CD146 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 648 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration By similarity. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Perikaryon. Note: Detected at the surface of the cell body of motor neurons. Ref.1 |
| Tissue specificity | Detected in lung, uterus and placenta (at protein level). Detected in heart, lung, kidney, adrenal gland, intestine, testis, skeletal muscle and aorta. Detected at low levels in adult brain, in particular in brain stem and spinal cord, but also in hippocampus, olfactory bulb and striatum (at protein level). Ref.1 |
| Developmental stage | Detected at high levels in brain throughout embryonic development (at protein level). Levels are lower in neonates and decrease during the first days after birth (at protein level). |
| Sequence similarities | Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 Ig-like V-type (immunoglobulin-like) domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW glomerular filtrationInferred from electronic annotation. Source: Compara vascular wound healingInferred from electronic annotation. Source: Compara |
| Cellular_component | external side of plasma membrane Inferred from electronic annotation. Source: Compara integral to membraneInferred from electronic annotation. Source: UniProtKB-KW perikaryonInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9EPF2-1) Also known as: L-gicerin; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9EPF2-2) Also known as: S-gicerin; The sequence of this isoform differs from the canonical sequence as follows: 600-648: ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH → MERNTSI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | By similarity | ||||||||
| Chain | 24 – 648 | 625 | Cell surface glycoprotein MUC18 | PRO_0000045461 | |||||||
Regions | |||||||||||
| Topological domain | 24 – 560 | 537 | Extracellular Potential | ||||||||
| Transmembrane | 561 – 581 | 21 | Helical; Potential | ||||||||
| Topological domain | 582 – 648 | 67 | Cytoplasmic Potential | ||||||||
| Domain | 24 – 131 | 108 | Ig-like V-type 1 | ||||||||
| Domain | 141 – 244 | 104 | Ig-like V-type 2 | ||||||||
| Domain | 246 – 332 | 87 | Ig-like C2-type 1 | ||||||||
| Domain | 337 – 426 | 90 | Ig-like C2-type 2 | ||||||||
| Domain | 432 – 512 | 81 | Ig-like C2-type 3 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 616 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 510 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 50 ↔ 118 | By similarity | |||||||||
| Disulfide bond | 163 ↔ 225 | By similarity | |||||||||
| Disulfide bond | 274 ↔ 322 | By similarity | |||||||||
| Disulfide bond | 367 ↔ 409 | By similarity | |||||||||
| Disulfide bond | 454 ↔ 501 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 600 – 648 | 49 | ITLPP…IDLRH → MERNTSI in isoform 2. | VSP_016941 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 214 | 1 | L → V in BAB16048. Ref.1 | ||||||||
| Sequence conflict | 214 | 1 | L → V in BAB16049. Ref.1 | ||||||||
| Sequence conflict | 227 | 1 | L → V in BAB16048. Ref.1 | ||||||||
| Sequence conflict | 227 | 1 | L → V in BAB16049. Ref.1 | ||||||||
| Sequence conflict | 231 | 1 | L → P in BAB16048. Ref.1 | ||||||||
| Sequence conflict | 231 | 1 | L → P in BAB16049. Ref.1 | ||||||||
| Sequence conflict | 510 | 1 | N → Y in BAB16048. Ref.1 | ||||||||
| Sequence conflict | 510 | 1 | N → Y in BAB16049. Ref.1 | ||||||||
| Sequence conflict | 526 | 1 | P → H in BAB16048. Ref.1 | ||||||||
| Sequence conflict | 526 | 1 | P → H in BAB16049. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of Gicerin/MUC18/CD146 in the rat nervous system." Taira E., Kohama K., Tsukamoto Y., Okumura S., Miki N. J. Cell. Physiol. 198:377-387(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: Sprague-Dawley. Tissue: Heart. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Heart. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB035506 mRNA. Translation: BAB16048.1. AB035507 mRNA. Translation: BAB16049.1. BC070916 mRNA. Translation: AAH70916.1. |
| IPI | IPI00189006. IPI00655266. |
| RefSeq | NP_001029181.1. NM_001034009.1. NP_076473.2. NM_023983.3. |
| UniGene | Rn.2694. |
3D structure databases | |
| ProteinModelPortal | Q9EPF2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10116.ENSRNOP00000010464. |
PTM databases | |
| PhosphoSite | Q9EPF2. |
Proteomic databases | |
| PaxDb | Q9EPF2. |
| PRIDE | Q9EPF2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000010463; ENSRNOP00000010464; ENSRNOG00000007726. |
| GeneID | 78967. |
| KEGG | rno:78967. |
| UCSC | RGD:620463. rat. |
Organism-specific databases | |
| CTD | 4162. |
| RGD | 620463. Mcam. |
Phylogenomic databases | |
| eggNOG | NOG116686. |
| GeneTree | ENSGT00530000063457. |
| HOGENOM | HOG000015427. |
| HOVERGEN | HBG002808. |
| InParanoid | Q9EPF2. |
| KO | K06534. |
| OrthoDB | EOG4ZGPBZ. |
Gene expression databases | |
| ArrayExpress | Q9EPF2. |
| Genevestigator | Q9EPF2. |
| GermOnline | ENSRNOG00000007726. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 5 hits. |
| InterPro | IPR013162. CD80_C2-set. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003599. Ig_sub. IPR003598. Ig_sub2. IPR013106. Ig_V-set. IPR013151. Immunoglobulin. [Graphical view] |
| Pfam | PF08205. C2-set_2. 1 hit. PF07679. I-set. 1 hit. PF00047. ig. 1 hit. PF07686. V-set. 1 hit. [Graphical view] |
| SMART | SM00409. IG. 2 hits. SM00408. IGc2. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 614412. |
Entry information
| Entry name | MUC18_RAT | ||||||||
| Accession | Primary (citable) accession number: Q9EPF2 Secondary accession number(s): Q6IRH8, Q9ESS8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
