Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9EPF2

- MUC18_RAT

UniProt

Q9EPF2 - MUC18_RAT

Protein

Cell surface glycoprotein MUC18

Gene

Mcam

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 99 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration By similarity.By similarity

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. glomerular filtration Source: Ensembl
    3. positive regulation of cell migration Source: RGD
    4. vascular wound healing Source: Ensembl

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cell surface glycoprotein MUC18
    Alternative name(s):
    Gicerin
    Melanoma cell adhesion molecule
    Melanoma-associated antigen MUC18
    CD_antigen: CD146
    Gene namesi
    Name:Mcam
    Synonyms:Muc18
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 8

    Organism-specific databases

    RGDi620463. Mcam.

    Subcellular locationi

    Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication. Perikaryon 1 Publication
    Note: Detected at the surface of the cell body of motor neurons.

    GO - Cellular componenti

    1. external side of plasma membrane Source: Ensembl
    2. extracellular space Source: RGD
    3. integral component of membrane Source: UniProtKB-KW
    4. nucleus Source: RGD
    5. perikaryon Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323By similarityAdd
    BLAST
    Chaini24 – 648625Cell surface glycoprotein MUC18PRO_0000045461Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi50 ↔ 118PROSITE-ProRule annotation
    Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi163 ↔ 225PROSITE-ProRule annotation
    Disulfide bondi274 ↔ 322PROSITE-ProRule annotation
    Disulfide bondi367 ↔ 409PROSITE-ProRule annotation
    Disulfide bondi454 ↔ 501PROSITE-ProRule annotation
    Glycosylationi510 – 5101N-linked (GlcNAc...)Sequence Analysis
    Modified residuei616 – 6161PhosphoserineBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ9EPF2.
    PRIDEiQ9EPF2.

    PTM databases

    PhosphoSiteiQ9EPF2.

    Expressioni

    Tissue specificityi

    Detected in lung, uterus and placenta (at protein level). Detected in heart, lung, kidney, adrenal gland, intestine, testis, skeletal muscle and aorta. Detected at low levels in adult brain, in particular in brain stem and spinal cord, but also in hippocampus, olfactory bulb and striatum (at protein level).1 Publication

    Developmental stagei

    Detected at high levels in brain throughout embryonic development (at protein level). Levels are lower in neonates and decrease during the first days after birth (at protein level).

    Gene expression databases

    GenevestigatoriQ9EPF2.

    Interactioni

    Protein-protein interaction databases

    BioGridi249375. 1 interaction.
    STRINGi10116.ENSRNOP00000010464.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9EPF2.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini24 – 560537ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini582 – 64867CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei561 – 58121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 131108Ig-like V-type 1Add
    BLAST
    Domaini141 – 244104Ig-like V-type 2Add
    BLAST
    Domaini246 – 33287Ig-like C2-type 1Add
    BLAST
    Domaini337 – 42690Ig-like C2-type 2Add
    BLAST
    Domaini432 – 51281Ig-like C2-type 3Add
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG116686.
    GeneTreeiENSGT00530000063457.
    HOGENOMiHOG000015427.
    HOVERGENiHBG002808.
    InParanoidiQ9EPF2.
    KOiK06534.
    OMAiDQGEKYI.
    OrthoDBiEOG7RFTH4.
    PhylomeDBiQ9EPF2.

    Family and domain databases

    Gene3Di2.60.40.10. 5 hits.
    InterProiIPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR013106. Ig_V-set.
    [Graphical view]
    PfamiPF08205. C2-set_2. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 2 hits.
    SM00408. IGc2. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 4 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9EPF2-1) [UniParc]FASTAAdd to Basket

    Also known as: L-gicerin

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGLPRLVCAF LFAACCCCRS ATGVPGEEKQ PTPTPDPVEV EVGNTALLKC    50
    GPAHPSGNFS QVEWFLIHKE RQIPIFRVHQ GKGQSEPGEY EHRLSLHGPG 100
    ATLALSQVTP HDDRMFLCKS KQPRPQDHYV QLQVYKAPEE PTIQANVLGI 150
    HVDIQELKEV ATCVGRNGYP IPQVIWYKNG RPLQEEENRV HIQSSQTVES 200
    SGLYTLKSVL SARLVKEDKD AQFYCELSYR LPSGNRMKES KEVTVPVLYP 250
    AEKVWVEVEP VGLLKEGDHV KIRCLTDGNP QPHFTINKKN PSTEEMEEES 300
    TDENGLLSLE PAQKHHSGVY QCQSLDLETT VMLSSDPLEL LVNYVSDVQV 350
    DPTAPEVQEG DSLTLTCKAE SNQDLEFEWL RDKTGQLLGK GPILQLNNVK 400
    REAGGRYLCV ASVPSVPGLN RTRRVSVGIF GSPWMAAKER KVWAQENAML 450
    NLSCEASGHP QPTISWNING SATEWNPDPQ TVVSTLNVLV TPELLETGAE 500
    CTASNSLGSN TTVIILKLVT LTTLTPDSSQ TTGLSTPTVS PHSRANSTST 550
    EKKLPQQESK GVVIVAVIVC TLVLAVLGAT LYYFYKKGKL PCGRSGKQEI 600
    TLPPTRKSEF VVEVKSDKLP EEMALLQGSN GDKRAPGDQG EKYIDLRH 648
    Length:648
    Mass (Da):71,327
    Last modified:January 10, 2006 - v2
    Checksum:i85B727C60D4BF4C3
    GO
    Isoform 2 (identifier: Q9EPF2-2) [UniParc]FASTAAdd to Basket

    Also known as: S-gicerin

    The sequence of this isoform differs from the canonical sequence as follows:
         600-648: ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH → MERNTSI

    Show »
    Length:606
    Mass (Da):66,683
    Checksum:i157F859B6C5EBF28
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti214 – 2141L → V in BAB16048. (PubMed:14755543)Curated
    Sequence conflicti214 – 2141L → V in BAB16049. (PubMed:14755543)Curated
    Sequence conflicti227 – 2271L → V in BAB16048. (PubMed:14755543)Curated
    Sequence conflicti227 – 2271L → V in BAB16049. (PubMed:14755543)Curated
    Sequence conflicti231 – 2311L → P in BAB16048. (PubMed:14755543)Curated
    Sequence conflicti231 – 2311L → P in BAB16049. (PubMed:14755543)Curated
    Sequence conflicti510 – 5101N → Y in BAB16048. (PubMed:14755543)Curated
    Sequence conflicti510 – 5101N → Y in BAB16049. (PubMed:14755543)Curated
    Sequence conflicti526 – 5261P → H in BAB16048. (PubMed:14755543)Curated
    Sequence conflicti526 – 5261P → H in BAB16049. (PubMed:14755543)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei600 – 64849ITLPP…IDLRH → MERNTSI in isoform 2. 2 PublicationsVSP_016941Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB035506 mRNA. Translation: BAB16048.1.
    AB035507 mRNA. Translation: BAB16049.1.
    BC070916 mRNA. Translation: AAH70916.1.
    RefSeqiNP_001029181.1. NM_001034009.1. [Q9EPF2-2]
    NP_076473.2. NM_023983.3. [Q9EPF2-1]
    UniGeneiRn.2694.

    Genome annotation databases

    EnsembliENSRNOT00000010463; ENSRNOP00000010464; ENSRNOG00000007726. [Q9EPF2-1]
    GeneIDi78967.
    KEGGirno:78967.
    UCSCiRGD:620463. rat. [Q9EPF2-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB035506 mRNA. Translation: BAB16048.1 .
    AB035507 mRNA. Translation: BAB16049.1 .
    BC070916 mRNA. Translation: AAH70916.1 .
    RefSeqi NP_001029181.1. NM_001034009.1. [Q9EPF2-2 ]
    NP_076473.2. NM_023983.3. [Q9EPF2-1 ]
    UniGenei Rn.2694.

    3D structure databases

    ProteinModelPortali Q9EPF2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 249375. 1 interaction.
    STRINGi 10116.ENSRNOP00000010464.

    PTM databases

    PhosphoSitei Q9EPF2.

    Proteomic databases

    PaxDbi Q9EPF2.
    PRIDEi Q9EPF2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000010463 ; ENSRNOP00000010464 ; ENSRNOG00000007726 . [Q9EPF2-1 ]
    GeneIDi 78967.
    KEGGi rno:78967.
    UCSCi RGD:620463. rat. [Q9EPF2-1 ]

    Organism-specific databases

    CTDi 4162.
    RGDi 620463. Mcam.

    Phylogenomic databases

    eggNOGi NOG116686.
    GeneTreei ENSGT00530000063457.
    HOGENOMi HOG000015427.
    HOVERGENi HBG002808.
    InParanoidi Q9EPF2.
    KOi K06534.
    OMAi DQGEKYI.
    OrthoDBi EOG7RFTH4.
    PhylomeDBi Q9EPF2.

    Miscellaneous databases

    NextBioi 614412.
    PROi Q9EPF2.

    Gene expression databases

    Genevestigatori Q9EPF2.

    Family and domain databases

    Gene3Di 2.60.40.10. 5 hits.
    InterProi IPR013162. CD80_C2-set.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR013106. Ig_V-set.
    [Graphical view ]
    Pfami PF08205. C2-set_2. 1 hit.
    PF07686. V-set. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 2 hits.
    SM00408. IGc2. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of Gicerin/MUC18/CD146 in the rat nervous system."
      Taira E., Kohama K., Tsukamoto Y., Okumura S., Miki N.
      J. Cell. Physiol. 198:377-387(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Strain: Sprague-Dawley.
      Tissue: Heart.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Heart.

    Entry informationi

    Entry nameiMUC18_RAT
    AccessioniPrimary (citable) accession number: Q9EPF2
    Secondary accession number(s): Q6IRH8, Q9ESS8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 10, 2006
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 99 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3