Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9EPF2

- MUC18_RAT

UniProt

Q9EPF2 - MUC18_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cell surface glycoprotein MUC18

Gene

Mcam

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration (By similarity).By similarity

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. glomerular filtration Source: Ensembl
  3. positive regulation of cell migration Source: RGD
  4. vascular wound healing Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Gicerin
Melanoma cell adhesion molecule
Melanoma-associated antigen MUC18
CD_antigen: CD146
Gene namesi
Name:Mcam
Synonyms:Muc18
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 8

Organism-specific databases

RGDi620463. Mcam.

Subcellular locationi

Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication. Perikaryon 1 Publication
Note: Detected at the surface of the cell body of motor neurons.

GO - Cellular componenti

  1. external side of plasma membrane Source: Ensembl
  2. extracellular space Source: RGD
  3. integral component of membrane Source: UniProtKB-KW
  4. nucleus Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323By similarityAdd
BLAST
Chaini24 – 648625Cell surface glycoprotein MUC18PRO_0000045461Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi50 ↔ 118PROSITE-ProRule annotation
Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi163 ↔ 225PROSITE-ProRule annotation
Disulfide bondi274 ↔ 322PROSITE-ProRule annotation
Disulfide bondi367 ↔ 409PROSITE-ProRule annotation
Disulfide bondi454 ↔ 501PROSITE-ProRule annotation
Glycosylationi510 – 5101N-linked (GlcNAc...)Sequence Analysis
Modified residuei616 – 6161PhosphoserineBy similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9EPF2.
PRIDEiQ9EPF2.

PTM databases

PhosphoSiteiQ9EPF2.

Expressioni

Tissue specificityi

Detected in lung, uterus and placenta (at protein level). Detected in heart, lung, kidney, adrenal gland, intestine, testis, skeletal muscle and aorta. Detected at low levels in adult brain, in particular in brain stem and spinal cord, but also in hippocampus, olfactory bulb and striatum (at protein level).1 Publication

Developmental stagei

Detected at high levels in brain throughout embryonic development (at protein level). Levels are lower in neonates and decrease during the first days after birth (at protein level).

Gene expression databases

GenevestigatoriQ9EPF2.

Interactioni

Protein-protein interaction databases

BioGridi249375. 1 interaction.
STRINGi10116.ENSRNOP00000010464.

Structurei

3D structure databases

ProteinModelPortaliQ9EPF2.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 560537ExtracellularSequence AnalysisAdd
BLAST
Topological domaini582 – 64867CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei561 – 58121HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 131108Ig-like V-type 1Add
BLAST
Domaini141 – 244104Ig-like V-type 2Add
BLAST
Domaini246 – 33287Ig-like C2-type 1Add
BLAST
Domaini337 – 42690Ig-like C2-type 2Add
BLAST
Domaini432 – 51281Ig-like C2-type 3Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG116686.
GeneTreeiENSGT00530000063457.
HOGENOMiHOG000015427.
HOVERGENiHBG002808.
InParanoidiQ9EPF2.
KOiK06534.
OMAiDQGEKYI.
OrthoDBiEOG7RFTH4.
PhylomeDBiQ9EPF2.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9EPF2-1) [UniParc]FASTAAdd to Basket

Also known as: L-gicerin

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLPRLVCAF LFAACCCCRS ATGVPGEEKQ PTPTPDPVEV EVGNTALLKC
60 70 80 90 100
GPAHPSGNFS QVEWFLIHKE RQIPIFRVHQ GKGQSEPGEY EHRLSLHGPG
110 120 130 140 150
ATLALSQVTP HDDRMFLCKS KQPRPQDHYV QLQVYKAPEE PTIQANVLGI
160 170 180 190 200
HVDIQELKEV ATCVGRNGYP IPQVIWYKNG RPLQEEENRV HIQSSQTVES
210 220 230 240 250
SGLYTLKSVL SARLVKEDKD AQFYCELSYR LPSGNRMKES KEVTVPVLYP
260 270 280 290 300
AEKVWVEVEP VGLLKEGDHV KIRCLTDGNP QPHFTINKKN PSTEEMEEES
310 320 330 340 350
TDENGLLSLE PAQKHHSGVY QCQSLDLETT VMLSSDPLEL LVNYVSDVQV
360 370 380 390 400
DPTAPEVQEG DSLTLTCKAE SNQDLEFEWL RDKTGQLLGK GPILQLNNVK
410 420 430 440 450
REAGGRYLCV ASVPSVPGLN RTRRVSVGIF GSPWMAAKER KVWAQENAML
460 470 480 490 500
NLSCEASGHP QPTISWNING SATEWNPDPQ TVVSTLNVLV TPELLETGAE
510 520 530 540 550
CTASNSLGSN TTVIILKLVT LTTLTPDSSQ TTGLSTPTVS PHSRANSTST
560 570 580 590 600
EKKLPQQESK GVVIVAVIVC TLVLAVLGAT LYYFYKKGKL PCGRSGKQEI
610 620 630 640
TLPPTRKSEF VVEVKSDKLP EEMALLQGSN GDKRAPGDQG EKYIDLRH
Length:648
Mass (Da):71,327
Last modified:January 10, 2006 - v2
Checksum:i85B727C60D4BF4C3
GO
Isoform 2 (identifier: Q9EPF2-2) [UniParc]FASTAAdd to Basket

Also known as: S-gicerin

The sequence of this isoform differs from the canonical sequence as follows:
     600-648: ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH → MERNTSI

Show »
Length:606
Mass (Da):66,683
Checksum:i157F859B6C5EBF28
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti214 – 2141L → V in BAB16048. (PubMed:14755543)Curated
Sequence conflicti214 – 2141L → V in BAB16049. (PubMed:14755543)Curated
Sequence conflicti227 – 2271L → V in BAB16048. (PubMed:14755543)Curated
Sequence conflicti227 – 2271L → V in BAB16049. (PubMed:14755543)Curated
Sequence conflicti231 – 2311L → P in BAB16048. (PubMed:14755543)Curated
Sequence conflicti231 – 2311L → P in BAB16049. (PubMed:14755543)Curated
Sequence conflicti510 – 5101N → Y in BAB16048. (PubMed:14755543)Curated
Sequence conflicti510 – 5101N → Y in BAB16049. (PubMed:14755543)Curated
Sequence conflicti526 – 5261P → H in BAB16048. (PubMed:14755543)Curated
Sequence conflicti526 – 5261P → H in BAB16049. (PubMed:14755543)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei600 – 64849ITLPP…IDLRH → MERNTSI in isoform 2. 2 PublicationsVSP_016941Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB035506 mRNA. Translation: BAB16048.1.
AB035507 mRNA. Translation: BAB16049.1.
BC070916 mRNA. Translation: AAH70916.1.
RefSeqiNP_001029181.1. NM_001034009.1. [Q9EPF2-2]
NP_076473.2. NM_023983.3. [Q9EPF2-1]
UniGeneiRn.2694.

Genome annotation databases

EnsembliENSRNOT00000010463; ENSRNOP00000010464; ENSRNOG00000007726. [Q9EPF2-1]
GeneIDi78967.
KEGGirno:78967.
UCSCiRGD:620463. rat. [Q9EPF2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB035506 mRNA. Translation: BAB16048.1 .
AB035507 mRNA. Translation: BAB16049.1 .
BC070916 mRNA. Translation: AAH70916.1 .
RefSeqi NP_001029181.1. NM_001034009.1. [Q9EPF2-2 ]
NP_076473.2. NM_023983.3. [Q9EPF2-1 ]
UniGenei Rn.2694.

3D structure databases

ProteinModelPortali Q9EPF2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 249375. 1 interaction.
STRINGi 10116.ENSRNOP00000010464.

PTM databases

PhosphoSitei Q9EPF2.

Proteomic databases

PaxDbi Q9EPF2.
PRIDEi Q9EPF2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000010463 ; ENSRNOP00000010464 ; ENSRNOG00000007726 . [Q9EPF2-1 ]
GeneIDi 78967.
KEGGi rno:78967.
UCSCi RGD:620463. rat. [Q9EPF2-1 ]

Organism-specific databases

CTDi 4162.
RGDi 620463. Mcam.

Phylogenomic databases

eggNOGi NOG116686.
GeneTreei ENSGT00530000063457.
HOGENOMi HOG000015427.
HOVERGENi HBG002808.
InParanoidi Q9EPF2.
KOi K06534.
OMAi DQGEKYI.
OrthoDBi EOG7RFTH4.
PhylomeDBi Q9EPF2.

Miscellaneous databases

NextBioi 614412.
PROi Q9EPF2.

Gene expression databases

Genevestigatori Q9EPF2.

Family and domain databases

Gene3Di 2.60.40.10. 5 hits.
InterProi IPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view ]
Pfami PF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of Gicerin/MUC18/CD146 in the rat nervous system."
    Taira E., Kohama K., Tsukamoto Y., Okumura S., Miki N.
    J. Cell. Physiol. 198:377-387(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
    Tissue: Heart.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Heart.

Entry informationi

Entry nameiMUC18_RAT
AccessioniPrimary (citable) accession number: Q9EPF2
Secondary accession number(s): Q6IRH8, Q9ESS8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: October 29, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3