Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9EPF2 (MUC18_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cell surface glycoprotein MUC18
Alternative name(s):
Gicerin
Melanoma cell adhesion molecule
Melanoma-associated antigen MUC18
CD_antigen=CD146
Gene names
Name:Mcam
Synonyms:Muc18
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length648 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration By similarity.

Subcellular location

Cell membrane; Single-pass type I membrane protein. Perikaryon. Note: Detected at the surface of the cell body of motor neurons. Ref.1

Tissue specificity

Detected in lung, uterus and placenta (at protein level). Detected in heart, lung, kidney, adrenal gland, intestine, testis, skeletal muscle and aorta. Detected at low levels in adult brain, in particular in brain stem and spinal cord, but also in hippocampus, olfactory bulb and striatum (at protein level). Ref.1

Developmental stage

Detected at high levels in brain throughout embryonic development (at protein level). Levels are lower in neonates and decrease during the first days after birth (at protein level).

Sequence similarities

Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Contains 2 Ig-like V-type (immunoglobulin-like) domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9EPF2-1)

Also known as: L-gicerin;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9EPF2-2)

Also known as: S-gicerin;

The sequence of this isoform differs from the canonical sequence as follows:
     600-648: ITLPPTRKSEFVVEVKSDKLPEEMALLQGSNGDKRAPGDQGEKYIDLRH → MERNTSI

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2323 By similarity
Chain24 – 648625Cell surface glycoprotein MUC18
PRO_0000045461

Regions

Topological domain24 – 560537Extracellular Potential
Transmembrane561 – 58121Helical; Potential
Topological domain582 – 64867Cytoplasmic Potential
Domain24 – 131108Ig-like V-type 1
Domain141 – 244104Ig-like V-type 2
Domain246 – 33287Ig-like C2-type 1
Domain337 – 42690Ig-like C2-type 2
Domain432 – 51281Ig-like C2-type 3

Amino acid modifications

Modified residue6161Phosphoserine By similarity
Glycosylation581N-linked (GlcNAc...) Potential
Glycosylation5101N-linked (GlcNAc...) Potential
Disulfide bond50 ↔ 118 By similarity
Disulfide bond163 ↔ 225 By similarity
Disulfide bond274 ↔ 322 By similarity
Disulfide bond367 ↔ 409 By similarity
Disulfide bond454 ↔ 501 By similarity

Natural variations

Alternative sequence600 – 64849ITLPP…IDLRH → MERNTSI in isoform 2.
VSP_016941

Experimental info

Sequence conflict2141L → V in BAB16048. Ref.1
Sequence conflict2141L → V in BAB16049. Ref.1
Sequence conflict2271L → V in BAB16048. Ref.1
Sequence conflict2271L → V in BAB16049. Ref.1
Sequence conflict2311L → P in BAB16048. Ref.1
Sequence conflict2311L → P in BAB16049. Ref.1
Sequence conflict5101N → Y in BAB16048. Ref.1
Sequence conflict5101N → Y in BAB16049. Ref.1
Sequence conflict5261P → H in BAB16048. Ref.1
Sequence conflict5261P → H in BAB16049. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (L-gicerin) [UniParc].

Last modified January 10, 2006. Version 2.
Checksum: 85B727C60D4BF4C3

FASTA64871,327
        10         20         30         40         50         60 
MGLPRLVCAF LFAACCCCRS ATGVPGEEKQ PTPTPDPVEV EVGNTALLKC GPAHPSGNFS 

        70         80         90        100        110        120 
QVEWFLIHKE RQIPIFRVHQ GKGQSEPGEY EHRLSLHGPG ATLALSQVTP HDDRMFLCKS 

       130        140        150        160        170        180 
KQPRPQDHYV QLQVYKAPEE PTIQANVLGI HVDIQELKEV ATCVGRNGYP IPQVIWYKNG 

       190        200        210        220        230        240 
RPLQEEENRV HIQSSQTVES SGLYTLKSVL SARLVKEDKD AQFYCELSYR LPSGNRMKES 

       250        260        270        280        290        300 
KEVTVPVLYP AEKVWVEVEP VGLLKEGDHV KIRCLTDGNP QPHFTINKKN PSTEEMEEES 

       310        320        330        340        350        360 
TDENGLLSLE PAQKHHSGVY QCQSLDLETT VMLSSDPLEL LVNYVSDVQV DPTAPEVQEG 

       370        380        390        400        410        420 
DSLTLTCKAE SNQDLEFEWL RDKTGQLLGK GPILQLNNVK REAGGRYLCV ASVPSVPGLN 

       430        440        450        460        470        480 
RTRRVSVGIF GSPWMAAKER KVWAQENAML NLSCEASGHP QPTISWNING SATEWNPDPQ 

       490        500        510        520        530        540 
TVVSTLNVLV TPELLETGAE CTASNSLGSN TTVIILKLVT LTTLTPDSSQ TTGLSTPTVS 

       550        560        570        580        590        600 
PHSRANSTST EKKLPQQESK GVVIVAVIVC TLVLAVLGAT LYYFYKKGKL PCGRSGKQEI 

       610        620        630        640 
TLPPTRKSEF VVEVKSDKLP EEMALLQGSN GDKRAPGDQG EKYIDLRH 

« Hide

Isoform 2 (S-gicerin) [UniParc].

Checksum: 157F859B6C5EBF28
Show »

FASTA60666,683

References

« Hide 'large scale' references
[1]"Characterization of Gicerin/MUC18/CD146 in the rat nervous system."
Taira E., Kohama K., Tsukamoto Y., Okumura S., Miki N.
J. Cell. Physiol. 198:377-387(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Strain: Sprague-Dawley.
Tissue: Heart.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Heart.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB035506 mRNA. Translation: BAB16048.1.
AB035507 mRNA. Translation: BAB16049.1.
BC070916 mRNA. Translation: AAH70916.1.
RefSeqNP_001029181.1. NM_001034009.1.
NP_076473.2. NM_023983.3.
UniGeneRn.2694.

3D structure databases

ProteinModelPortalQ9EPF2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid249375. 1 interaction.
STRING10116.ENSRNOP00000010464.

PTM databases

PhosphoSiteQ9EPF2.

Proteomic databases

PaxDbQ9EPF2.
PRIDEQ9EPF2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000010463; ENSRNOP00000010464; ENSRNOG00000007726. [Q9EPF2-1]
GeneID78967.
KEGGrno:78967.
UCSCRGD:620463. rat. [Q9EPF2-1]

Organism-specific databases

CTD4162.
RGD620463. Mcam.

Phylogenomic databases

eggNOGNOG116686.
GeneTreeENSGT00530000063457.
HOGENOMHOG000015427.
HOVERGENHBG002808.
InParanoidQ9EPF2.
KOK06534.
OMADQGEKYI.
OrthoDBEOG7RFTH4.
PhylomeDBQ9EPF2.

Gene expression databases

GenevestigatorQ9EPF2.

Family and domain databases

Gene3D2.60.40.10. 5 hits.
InterProIPR013162. CD80_C2-set.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR013106. Ig_V-set.
[Graphical view]
PfamPF08205. C2-set_2. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTSM00409. IG. 2 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio614412.
PROQ9EPF2.

Entry information

Entry nameMUC18_RAT
AccessionPrimary (citable) accession number: Q9EPF2
Secondary accession number(s): Q6IRH8, Q9ESS8
Entry history
Integrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: April 16, 2014
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families