Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Blood vessel epicardial substance

Gene

BVES

Organism
Gallus gallus (Chicken)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca2+-independent manner. Involved in epithelial movement during corneal sheet formation and regeneration. May play a role in VAMP3-mediated vesicular transport and recycling of receptor molecules. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May be involved in skeletal muscle and heart development (By similarity). May also be involved in striated muscle regeneration and in the regulation of cell spreading.By similarity2 Publications

GO - Molecular functioni

  • cAMP binding Source: Ensembl
  • structural molecule activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Blood vessel epicardial substance
Alternative name(s):
Popeye domain-containing protein 1
Short name:
Popeye protein 1
Gene namesi
Name:BVES
Synonyms:POP1, POPDC1
OrganismiGallus gallus (Chicken)
Taxonomic identifieri9031 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiArchelosauriaArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalloanseraeGalliformesPhasianidaePhasianinaeGallus
Proteomesi
  • UP000000539 Componenti: Chromosome 3

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3838ExtracellularSequence analysisAdd
BLAST
Transmembranei39 – 5921HelicalSequence analysisAdd
BLAST
Topological domaini60 – 623CytoplasmicSequence analysis
Transmembranei63 – 8321HelicalSequence analysisAdd
BLAST
Topological domaini84 – 896ExtracellularSequence analysis
Transmembranei90 – 11021HelicalSequence analysisAdd
BLAST
Topological domaini111 – 357247CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • bicellular tight junction Source: UniProtKB
  • cell Source: AgBase
  • cell periphery Source: AgBase
  • cell projection membrane Source: Ensembl
  • cytoplasm Source: AgBase
  • integral component of membrane Source: UniProtKB
  • intrinsic component of endoplasmic reticulum membrane Source: AgBase
  • lateral plasma membrane Source: UniProtKB
  • perinuclear region of cytoplasm Source: AgBase
  • plasma membrane Source: UniProtKB
  • sarcolemma Source: UniProtKB
  • spanning component of membrane Source: AgBase
  • spanning component of plasma membrane Source: AgBase
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi272 – 2721K → A: Abolishes homodimerization and cell-cell adhesion; when associated with A-273. 1 Publication
Mutagenesisi273 – 2731K → A: Abolishes homodimerization and cell-cell adhesion; when associated with A-272. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 357357Blood vessel epicardial substancePRO_0000394478Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi20 – 201N-linked (GlcNAc...)Sequence analysis
Glycosylationi27 – 271N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9DG23.

Expressioni

Tissue specificityi

Expressed in the heart and skeletal muscle (at protein level). Isoform 1 and isoform 4: expressed in heart, muscle, brain, stomach, kidney, lung and spleen.3 Publications

Developmental stagei

Expressed during heart development in the proepicardial organ, migrating proepicardial strands, delaminated mesenchymal cells and vascular smooth muscle. Expressed in epithelial precursors of the cornea, lens and retina of the developing eye (at protein level). Expressed in the left ventricular segment of the tubular heart at stage 11. Expressed in the myotome, notochord and ventral half of the neuronal tube.2 Publications

Interactioni

Subunit structurei

Homodimer. Homodimerization requires the C-terminus cytoplasmic region.1 Publication

Protein-protein interaction databases

STRINGi9031.ENSGALP00000024812.

Family & Domainsi

Sequence similaritiesi

Belongs to the popeye family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGHK. Eukaryota.
ENOG410ZTIT. LUCA.
GeneTreeiENSGT00390000002563.
HOGENOMiHOG000236292.
HOVERGENiHBG053638.
InParanoidiQ9DG23.
OMAiTIGCTLY.
OrthoDBiEOG7J180F.
PhylomeDBiQ9DG23.

Family and domain databases

InterProiIPR018490. cNMP-bd-like.
IPR006916. Popeye_prot.
[Graphical view]
PANTHERiPTHR12101. PTHR12101. 1 hit.
PfamiPF04831. Popeye. 1 hit.
[Graphical view]
SUPFAMiSSF51206. SSF51206. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DG23-1) [UniParc]FASTAAdd to basket

Also known as: POP1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTTAISPLT PLGVIPDLKN ATSVPFNETA CENWKEIHHL VFHVANICFA
60 70 80 90 100
AGLVIPTTLN LHMIFLRGLL TVGCALFIIW ATLYRCALDI MIWNSVFLVV
110 120 130 140 150
NLLHFIYLVY KRRPIKIEKE LSSLYKRMFE PLHVPPELFQ RLTGQFCNIQ
160 170 180 190 200
TLKTGQAYAA EDKTSVDDRL SILLKGKMKV SYRGHFLHNI YPCAFIDSPE
210 220 230 240 250
FRSTQMNRGE KFQVTIIADD NCKFLCWSRE RLTYFLETEP FLYEIFKYLI
260 270 280 290 300
GKDITNKLYS LNDPTLNDKA SKKIDRQPSL CSQLSVMQMR NSMASTSDSE
310 320 330 340 350
DGLQMFLRGT SSSSSLRPGR TSPYLRTSAK MKPIEESVED DVFEAPSAEK

LELQRLP
Length:357
Mass (Da):40,877
Last modified:March 1, 2001 - v1
Checksum:i5CB9194C10924535
GO
Isoform 2 (identifier: Q9DG23-2) [UniParc]FASTAAdd to basket

Also known as: POP1B

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MDTTAISPLTPLGVIPDLKNATSVPFNETACENWKEIHHLVFHV → NSRIRVPW
     318-324: PGRTSPY → NNPTRVL
     325-357: Missing.

Note: Incomplete sequence.
Show »
Length:288
Mass (Da):33,314
Checksum:iE537B53E11BED626
GO
Isoform 3 (identifier: Q9DG23-3) [UniParc]FASTAAdd to basket

Also known as: POP1C

The sequence of this isoform differs from the canonical sequence as follows:
     1-155: MDTTAISPLT...FCNIQTLKTG → MLPPMVPGSSNSRIRVPW
     317-357: RPGRTSPYLR...AEKLELQRLP → LTGPAEPPPL...HLNKLALSEA

Show »
Length:305
Mass (Da):33,865
Checksum:i21A3D52F576EE0F2
GO
Isoform 4 (identifier: Q9DG23-4) [UniParc]FASTAAdd to basket

Also known as: POP1D

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGENASFWES...WGRGLGFFKM
     317-357: RPGRTSPYLR...AEKLELQRLP → LTGPAEPPPL...SSMHWSWSFA

Show »
Length:693
Mass (Da):78,648
Checksum:i73AD157AA7261D0A
GO

Sequence cautioni

The sequence AAD51779.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti295 – 2962ST → RS in AAD51779 (PubMed:10208750).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 155155MDTTA…TLKTG → MLPPMVPGSSNSRIRVPW in isoform 3. 1 PublicationVSP_039262Add
BLAST
Alternative sequencei1 – 4444MDTTA…LVFHV → NSRIRVPW in isoform 2. 1 PublicationVSP_039263Add
BLAST
Alternative sequencei1 – 11M → MGENASFWESLIYAHPTCVT WKQEAEGSIYHLASILFVVG FMGGSGFSGLLYVFSLLGLG FLCSSVWAWLDVCAADIFSW NFILFAICFVQFIYVTYQVR SVSFDKEFQELYSALFQPLG ISLTVYRKIVLCCDAEVITL EKEHCYAMQGKTPIDKLSLL VSGRIRVTVDGEFLHYIFPL QFLDSPEWDSLRPTEEGIFQ VTLTAETDCRYVAWRRKKLY LLFAKHRFISRLFSILIGSD IAEKLYALNDRCTWGRGLGF FKM in isoform 4. 1 PublicationVSP_039264
Alternative sequencei317 – 35741RPGRT…LQRLP → LTGPAEPPPLIGSSIASARK LSTTVSRNLLAYLCLALLPP DMGSQSSQVPRPSTVNIIQL SEEGFHLLALLDQAADTCWK SPVLVCSLILPISSQLAFHL FQGKALCTGAGPLHRRHLNK LALSEA in isoform 3. 1 PublicationVSP_039265Add
BLAST
Alternative sequencei317 – 35741RPGRT…LQRLP → LTGPAEPPPLIGSSIASARK LSTTVSRNLLAYLCLALLPP DMGSQSSEVPRPSTVKTSSS YLKKASIYLLFLIRQQIPAV KSPVLVCSLIFTHKLSAGFS PVSRQSSMHWSWSFA in isoform 4. 1 PublicationVSP_039266Add
BLAST
Alternative sequencei318 – 3247PGRTSPY → NNPTRVL in isoform 2. 1 PublicationVSP_039267
Alternative sequencei325 – 35733Missing in isoform 2. 1 PublicationVSP_039268Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124511 mRNA. Translation: AAD51779.1. Different initiation.
AF208398 mRNA. Translation: AAG23410.1.
AF208399 mRNA. Translation: AAG23411.1.
AF208400 mRNA. Translation: AAG23412.1.
AF208401 mRNA. Translation: AAG23413.1.
RefSeqiNP_001001299.2. NM_001001299.2. [Q9DG23-1]
UniGeneiGga.3373.

Genome annotation databases

EnsembliENSGALT00000037249; ENSGALP00000036453; ENSGALG00000015410. [Q9DG23-1]
GeneIDi408032.
KEGGigga:408032.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124511 mRNA. Translation: AAD51779.1. Different initiation.
AF208398 mRNA. Translation: AAG23410.1.
AF208399 mRNA. Translation: AAG23411.1.
AF208400 mRNA. Translation: AAG23412.1.
AF208401 mRNA. Translation: AAG23413.1.
RefSeqiNP_001001299.2. NM_001001299.2. [Q9DG23-1]
UniGeneiGga.3373.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9031.ENSGALP00000024812.

Proteomic databases

PaxDbiQ9DG23.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSGALT00000037249; ENSGALP00000036453; ENSGALG00000015410. [Q9DG23-1]
GeneIDi408032.
KEGGigga:408032.

Organism-specific databases

CTDi11149.

Phylogenomic databases

eggNOGiENOG410IGHK. Eukaryota.
ENOG410ZTIT. LUCA.
GeneTreeiENSGT00390000002563.
HOGENOMiHOG000236292.
HOVERGENiHBG053638.
InParanoidiQ9DG23.
OMAiTIGCTLY.
OrthoDBiEOG7J180F.
PhylomeDBiQ9DG23.

Miscellaneous databases

NextBioi20818644.
PROiQ9DG23.

Family and domain databases

InterProiIPR018490. cNMP-bd-like.
IPR006916. Popeye_prot.
[Graphical view]
PANTHERiPTHR12101. PTHR12101. 1 hit.
PfamiPF04831. Popeye. 1 hit.
[Graphical view]
SUPFAMiSSF51206. SSF51206. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "bves: a novel gene expressed during coronary blood vessel development."
    Reese D.E., Zavaljevski M., Streiff N.L., Bader D.
    Dev. Biol. 209:159-171(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Heart.
  2. "Isolation and characterization of the novel popeye gene family expressed in skeletal muscle and heart."
    Andree B., Hillemann T., Kessler-Icekson G., Schmitt-John T., Jockusch H., Arnold H.-H., Brand T.
    Dev. Biol. 223:371-382(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [MRNA] OF 37-357 (ISOFORM 2), TISSUE SPECIFICITY.
  3. "Bves is expressed in the epithelial components of the retina, lens, and cornea."
    Ripley A.N., Chang M.S., Bader D.M.
    Invest. Ophthalmol. Vis. Sci. 45:2475-2483(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  4. "Bves modulates epithelial integrity through an interaction at the tight junction."
    Osler M.E., Chang M.S., Bader D.M.
    J. Cell Sci. 118:4667-4678(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  5. "Identification of a novel intracellular interaction domain essential for Bves function."
    Kawaguchi M., Hager H.A., Wada A., Koyama T., Chang M.S., Bader D.M.
    PLoS ONE 3:E2261-E2261(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: HOMODIMER, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-272 AND LYS-273.

Entry informationi

Entry nameiPOPD1_CHICK
AccessioniPrimary (citable) accession number: Q9DG23
Secondary accession number(s): Q9DG20
, Q9DG21, Q9DG22, Q9PWC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 15, 2010
Last sequence update: March 1, 2001
Last modified: April 13, 2016
This is version 68 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.