Q9DCT6 (BAP18_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 77.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Chromatin complexes subunit BAP18 Alternative name(s): BPTF-associated protein of 18 kDa | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 171 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of chromatin complexes such as the MLL1/MLL and NURF complexes By similarity. |
| Subunit structure | Component of some MLL1/MLL complex, at least composed of the core components MLL, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components C17orf49, CHD8, E2F6, HSP70, IN80C, KIAA1267, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the nucleosome-remodeling factor (NURF) complex By similarity. |
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Contains 1 SANT domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| Molecular function | Chromatin regulator |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | chromatin modification Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | MLL1 complex Inferred from sequence or structural similarity. Source: UniProtKB NURF complexInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9DCT6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9DCT6-2) The sequence of this isoform differs from the canonical sequence as follows: 137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC | ||||||
| Isoform 3 (identifier: Q9DCT6-3) The sequence of this isoform differs from the canonical sequence as follows: 41-74: Missing. | ||||||
| Isoform 4 (identifier: Q9DCT6-4) The sequence of this isoform differs from the canonical sequence as follows: 41-74: Missing. 137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 171 | 171 | Chromatin complexes subunit BAP18 | PRO_0000264252 | |||||
Regions | |||||||||
| Domain | 38 – 83 | 46 | SANT | ||||||
Amino acid modifications | |||||||||
| Modified residue | 36 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 96 | 1 | Phosphoserine Ref.4 Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 41 – 74 | 34 | Missing in isoform 3 and isoform 4. | VSP_021892 | |||||
| Alternative sequence | 137 – 171 | 35 | VTLSA…NFDQA → SLTLDSGLLTTSADAPLLSC in isoform 2 and isoform 4. | VSP_021893 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4). Strain: C57BL/6J. Tissue: Embryo, Embryonic heart and Kidney. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: NMRI. Tissue: Mammary gland. |
| [4] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed: 19367708] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, MASS SPECTROMETRY. Tissue: Melanoma. |
| [5] | "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) [PubMed: 19131326] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, MASS SPECTROMETRY. Tissue: Embryonic fibroblast. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK002491 mRNA. Translation: BAB22140.1. AK003842 mRNA. Translation: BAB23031.1. AK169173 mRNA. Translation: BAE40952.1. AK170380 mRNA. Translation: BAE41758.1. AL669869 Genomic DNA. Translation: CAI35229.1. AL669869 Genomic DNA. Translation: CAI35230.1. BC055357 mRNA. Translation: AAH55357.1. |
| IPI | IPI00265101. IPI00408937. IPI00654032. IPI00757518. |
| RefSeq | NP_001171072.1. NM_001177601.1. NP_001171074.1. NM_001177603.1. NP_001171077.1. NM_001177606.1. NP_001171078.1. NM_001177607.1. NP_081033.1. NM_026757.2. NP_665701.1. NM_145758.1. |
| UniGene | Mm.39265. |
3D structure databases | |
| ProteinModelPortal | Q9DCT6. |
| SMR | Q9DCT6. Positions 35-81. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9DCT6. |
PTM databases | |
| PhosphoSite | Q9DCT6. |
Proteomic databases | |
| PRIDE | Q9DCT6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000021181; ENSMUSP00000021181; ENSMUSG00000020831. ENSMUST00000102569; ENSMUSP00000099629; ENSMUSG00000020831. ENSMUST00000108578; ENSMUSP00000104219; ENSMUSG00000020831. ENSMUST00000108579; ENSMUSP00000104220; ENSMUSG00000020831. |
| GeneID | 104457. |
| KEGG | mmu:104457. |
| NMPDR | fig|10090.3.peg.24551. |
Organism-specific databases | |
| MGI | MGI:1915609. 0610010K14Rik. |
Phylogenomic databases | |
| GeneTree | ENSGT00390000014721. |
| HOVERGEN | HBG056647. |
| OMA | VAQIKST. |
| PhylomeDB | Q9DCT6. |
Gene expression databases | |
| ArrayExpress | Q9DCT6. |
| Bgee | Q9DCT6. |
| CleanEx | MM_0610010K14RIK. |
| Genevestigator | Q9DCT6. |
| GermOnline | ENSMUSG00000020831. Mus musculus. |
Family and domain databases | |
| InterPro | IPR009057. Homeodomain-like. IPR001005. SANT_DNA-bd. [Graphical view] |
| SMART | SM00717. SANT. 1 hit. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. |
| PROSITE | PS51293. SANT. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 357140. |
| SOURCE | Search... |
Entry information
| Entry name | BAP18_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9DCT6 Secondary accession number(s): Q3TFE6, Q7TMP3, Q9D183 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with