Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chromatin complexes subunit BAP18

Gene

Bap18

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Component of chromatin complexes such as the MLL1/MLL and NURF complexes.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Chromatin complexes subunit BAP18
Alternative name(s):
BPTF-associated protein of 18 kDa
Gene namesi
Name:Bap18
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1915609. 0610010K14Rik.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 171171Chromatin complexes subunit BAP18PRO_0000264252Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei96 – 961PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9DCT6.
MaxQBiQ9DCT6.
PaxDbiQ9DCT6.
PRIDEiQ9DCT6.

PTM databases

iPTMnetiQ9DCT6.
PhosphoSiteiQ9DCT6.

Expressioni

Gene expression databases

BgeeiQ9DCT6.
CleanExiMM_0610010K14RIK.
ExpressionAtlasiQ9DCT6. baseline.
GenevisibleiQ9DCT6. MM.

Interactioni

Subunit structurei

Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the nucleosome-remodeling factor (NURF) complex (By similarity).By similarity

Protein-protein interaction databases

BioGridi222642. 2 interactions.
IntActiQ9DCT6. 2 interactions.
STRINGi10090.ENSMUSP00000104216.

Structurei

3D structure databases

ProteinModelPortaliQ9DCT6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini38 – 8346SANTAdd
BLAST

Sequence similaritiesi

Contains 1 SANT domain.Curated

Phylogenomic databases

eggNOGiKOG4834. Eukaryota.
ENOG4111K4E. LUCA.
GeneTreeiENSGT00390000014721.
HOVERGENiHBG056647.
InParanoidiQ9DCT6.
PhylomeDBiQ9DCT6.

Family and domain databases

InterProiIPR009057. Homeodomain-like.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DCT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSASTKVGE IFSAAGAAFT KLGELTMQLH PVSDSSPAGA KWTETEIEML
60 70 80 90 100
RAAVKRFGDD LNHISCVIKE RTVAQIKTTV KRKVYEDSGI PLPAESPKKG
110 120 130 140 150
PKKMTSGVLS PPNAPPPSSS SVPEAGVPPI KKQKADVTLS ALNDSDANSD
160 170
LVDVEGLGET PPAKKLNFDQ A
Length:171
Mass (Da):17,996
Last modified:June 1, 2001 - v1
Checksum:iE7D10D1429D0BABF
GO
Isoform 2 (identifier: Q9DCT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC

Show »
Length:156
Mass (Da):16,330
Checksum:i5C0E7A3235E3500C
GO
Isoform 3 (identifier: Q9DCT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.

Show »
Length:137
Mass (Da):14,054
Checksum:i2E8ACD3296217841
GO
Isoform 4 (identifier: Q9DCT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.
     137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC

Show »
Length:122
Mass (Da):12,387
Checksum:i686BA4E3F584A4DD
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei41 – 7434Missing in isoform 3 and isoform 4. 1 PublicationVSP_021892Add
BLAST
Alternative sequencei137 – 17135VTLSA…NFDQA → SLTLDSGLLTTSADAPLLSC in isoform 2 and isoform 4. 2 PublicationsVSP_021893Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002491 mRNA. Translation: BAB22140.1.
AK003842 mRNA. Translation: BAB23031.1.
AK169173 mRNA. Translation: BAE40952.1.
AK170380 mRNA. Translation: BAE41758.1.
AL669869 Genomic DNA. Translation: CAI35229.1.
AL669869 Genomic DNA. Translation: CAI35230.1.
BC055357 mRNA. Translation: AAH55357.1.
CCDSiCCDS24940.1. [Q9DCT6-3]
CCDS48832.1. [Q9DCT6-4]
CCDS48833.1. [Q9DCT6-2]
CCDS48835.1. [Q9DCT6-1]
RefSeqiNP_001171072.1. NM_001177601.1.
NP_001171074.1. NM_001177603.1. [Q9DCT6-2]
NP_001171077.1. NM_001177606.1. [Q9DCT6-4]
NP_001171078.1. NM_001177607.1.
NP_081033.1. NM_026757.2. [Q9DCT6-3]
NP_665701.1. NM_145758.1. [Q9DCT6-1]
UniGeneiMm.30016.
Mm.39265.

Genome annotation databases

EnsembliENSMUST00000021181; ENSMUSP00000021181; ENSMUSG00000020831. [Q9DCT6-2]
ENSMUST00000102569; ENSMUSP00000099629; ENSMUSG00000020831. [Q9DCT6-3]
ENSMUST00000108578; ENSMUSP00000104219; ENSMUSG00000020831. [Q9DCT6-1]
ENSMUST00000108579; ENSMUSP00000104220; ENSMUSG00000020831. [Q9DCT6-4]
GeneIDi104457.
KEGGimmu:104457.
UCSCiuc007jud.2. mouse. [Q9DCT6-2]
uc007jue.2. mouse. [Q9DCT6-4]
uc007jug.2. mouse. [Q9DCT6-3]
uc007juh.2. mouse. [Q9DCT6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002491 mRNA. Translation: BAB22140.1.
AK003842 mRNA. Translation: BAB23031.1.
AK169173 mRNA. Translation: BAE40952.1.
AK170380 mRNA. Translation: BAE41758.1.
AL669869 Genomic DNA. Translation: CAI35229.1.
AL669869 Genomic DNA. Translation: CAI35230.1.
BC055357 mRNA. Translation: AAH55357.1.
CCDSiCCDS24940.1. [Q9DCT6-3]
CCDS48832.1. [Q9DCT6-4]
CCDS48833.1. [Q9DCT6-2]
CCDS48835.1. [Q9DCT6-1]
RefSeqiNP_001171072.1. NM_001177601.1.
NP_001171074.1. NM_001177603.1. [Q9DCT6-2]
NP_001171077.1. NM_001177606.1. [Q9DCT6-4]
NP_001171078.1. NM_001177607.1.
NP_081033.1. NM_026757.2. [Q9DCT6-3]
NP_665701.1. NM_145758.1. [Q9DCT6-1]
UniGeneiMm.30016.
Mm.39265.

3D structure databases

ProteinModelPortaliQ9DCT6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi222642. 2 interactions.
IntActiQ9DCT6. 2 interactions.
STRINGi10090.ENSMUSP00000104216.

PTM databases

iPTMnetiQ9DCT6.
PhosphoSiteiQ9DCT6.

Proteomic databases

EPDiQ9DCT6.
MaxQBiQ9DCT6.
PaxDbiQ9DCT6.
PRIDEiQ9DCT6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021181; ENSMUSP00000021181; ENSMUSG00000020831. [Q9DCT6-2]
ENSMUST00000102569; ENSMUSP00000099629; ENSMUSG00000020831. [Q9DCT6-3]
ENSMUST00000108578; ENSMUSP00000104219; ENSMUSG00000020831. [Q9DCT6-1]
ENSMUST00000108579; ENSMUSP00000104220; ENSMUSG00000020831. [Q9DCT6-4]
GeneIDi104457.
KEGGimmu:104457.
UCSCiuc007jud.2. mouse. [Q9DCT6-2]
uc007jue.2. mouse. [Q9DCT6-4]
uc007jug.2. mouse. [Q9DCT6-3]
uc007juh.2. mouse. [Q9DCT6-1]

Organism-specific databases

MGIiMGI:1915609. 0610010K14Rik.

Phylogenomic databases

eggNOGiKOG4834. Eukaryota.
ENOG4111K4E. LUCA.
GeneTreeiENSGT00390000014721.
HOVERGENiHBG056647.
InParanoidiQ9DCT6.
PhylomeDBiQ9DCT6.

Miscellaneous databases

ChiTaRSi0610010K14Rik. mouse.
NextBioi357140.
PROiQ9DCT6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9DCT6.
CleanExiMM_0610010K14RIK.
ExpressionAtlasiQ9DCT6. baseline.
GenevisibleiQ9DCT6. MM.

Family and domain databases

InterProiIPR009057. Homeodomain-like.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: C57BL/6J.
    Tissue: Embryo, Embryonic heart and Kidney.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: NMRI.
    Tissue: Mammary gland.
  4. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney, Liver, Lung, Spleen and Testis.

Entry informationi

Entry nameiBAP18_MOUSE
AccessioniPrimary (citable) accession number: Q9DCT6
Secondary accession number(s): Q3TFE6, Q7TMP3, Q9D183
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: May 11, 2016
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.