Reviewed,
UniProtKB/Swiss-Prot Q9DCT6 (CQ049_MOUSE)
Last modified
November 24, 2009.
Version 62.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Uncharacterized potential DNA-binding protein C17orf49 homolog |
| Organism | Mus musculus (Mouse) |
| Taxonomic identifier | 10090 [NCBI] |
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 171 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subcellular location | Nucleus Potential. |
| Sequence similarities | Contains 1 SANT domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9DCT6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9DCT6-2) The sequence of this isoform differs from the canonical sequence as follows: 137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC | ||||||
| Isoform 3 (identifier: Q9DCT6-3) The sequence of this isoform differs from the canonical sequence as follows: 41-74: Missing. | ||||||
| Isoform 4 (identifier: Q9DCT6-4) The sequence of this isoform differs from the canonical sequence as follows: 41-74: Missing. 137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 171 | 171 | Uncharacterized potential DNA-binding protein C17orf49 homolog | PRO_0000264252 | |||||
Regions | |||||||||
| Domain | 38 – 83 | 46 | SANT | ||||||
Amino acid modifications | |||||||||
| Modified residue | 36 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 96 | 1 | Phosphoserine Ref.4 Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 41 – 74 | 34 | Missing in isoform 3 and isoform 4. | VSP_021892 | |||||
| Alternative sequence | 137 – 171 | 35 | VTLSA…NFDQA → SLTLDSGLLTTSADAPLLSC in isoform 2 and isoform 4. | VSP_021893 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4). Strain: C57BL/6J. Tissue: Embryo, Embryonic heart and Kidney. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: NMRI. Tissue: Mammary gland. |
| [4] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed: 18973353] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, MASS SPECTROMETRY. |
| [5] | "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) [PubMed: 19131326] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AK002491 mRNA. Translation: BAB22140.1. AK003842 mRNA. Translation: BAB23031.1. AK169173 mRNA. Translation: BAE40952.1. AK170380 mRNA. Translation: BAE41758.1. AL669869 Genomic DNA. Translation: CAI35229.1. AL669869 Genomic DNA. Translation: CAI35230.1. BC055357 mRNA. Translation: AAH55357.1. | |
| IPI | IPI00265101. IPI00408937. IPI00654032. IPI00757518. |
| RefSeq | NP_081033.1. |
| UniGene | Mm.39265 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9DCT6. |
Proteomic databases | |
| PRIDE | Q9DCT6. |
Genome annotation databases | |
| Ensembl | ENSMUST00000021181; ENSMUSP00000021181; ENSMUSG00000020831; Mus musculus. [Genome view] ENSMUST00000081826; ENSMUSP00000080510; ENSMUSG00000020831; Mus musculus. [Genome view] ENSMUST00000102569; ENSMUSP00000099629; ENSMUSG00000020831; Mus musculus. [Genome view] ENSMUST00000108578; ENSMUSP00000104219; ENSMUSG00000020831; Mus musculus. [Genome view] |
| GeneID | 104457. |
| KEGG | mmu:104457. |
| NMPDR | fig|10090.3.peg.24551. |
| UCSC | uc007jud.1. mouse. uc007jue.1. mouse. uc007jug.1. mouse. uc007juh.1. mouse. |
Organism-specific databases | |
| MGI | MGI:1915609. 0610010K14Rik. |
Phylogenomic databases | |
| HOVERGEN | Q9DCT6. |
| OMA | WTDTEIE. |
Gene expression databases | |
| ArrayExpress | Q9DCT6. |
| Bgee | Q9DCT6. |
| CleanEx | MM_0610010K14RIK. |
| Genevestigator | Q9DCT6. |
| GermOnline | ENSMUSG00000020831. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001005. SANT_DNA-bd. [Graphical view] |
| SMART | SM00717. SANT. 1 hit. [Graphical view] |
| PROSITE | PS51293. SANT. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 357140. |
Entry information
| Entry name | CQ049_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9DCT6 Secondary accession number(s): Q3TFE6, Q7TMP3, Q9D183 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


