Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chromatin complexes subunit BAP18

Gene

Bap18

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of chromatin complexes such as the MLL1/MLL and NURF complexes.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator, DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Chromatin complexes subunit BAP18
Alternative name(s):
BPTF-associated protein of 18 kDa
Gene namesi
Name:Bap18
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1915609 0610010K14Rik

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002642521 – 171Chromatin complexes subunit BAP18Add BLAST171

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei96PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9DCT6
PeptideAtlasiQ9DCT6
PRIDEiQ9DCT6

PTM databases

iPTMnetiQ9DCT6
PhosphoSitePlusiQ9DCT6

Expressioni

Gene expression databases

BgeeiENSMUSG00000020831
CleanExiMM_0610010K14RIK
ExpressionAtlasiQ9DCT6 baseline and differential
GenevisibleiQ9DCT6 MM

Interactioni

Subunit structurei

Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the nucleosome-remodeling factor (NURF) complex (By similarity).By similarity

Protein-protein interaction databases

BioGridi222642, 2 interactors
IntActiQ9DCT6, 2 interactors
MINTiQ9DCT6
STRINGi10090.ENSMUSP00000104216

Structurei

3D structure databases

ProteinModelPortaliQ9DCT6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini38 – 83SANTAdd BLAST46

Phylogenomic databases

eggNOGiKOG4834 Eukaryota
ENOG4111K4E LUCA
GeneTreeiENSGT00390000014721
HOVERGENiHBG056647
InParanoidiQ9DCT6
PhylomeDBiQ9DCT6

Family and domain databases

CDDicd00167 SANT, 1 hit
InterProiView protein in InterPro
IPR037931 BAP18
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
PANTHERiPTHR21397:SF2 PTHR21397:SF2, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DCT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSASTKVGE IFSAAGAAFT KLGELTMQLH PVSDSSPAGA KWTETEIEML
60 70 80 90 100
RAAVKRFGDD LNHISCVIKE RTVAQIKTTV KRKVYEDSGI PLPAESPKKG
110 120 130 140 150
PKKMTSGVLS PPNAPPPSSS SVPEAGVPPI KKQKADVTLS ALNDSDANSD
160 170
LVDVEGLGET PPAKKLNFDQ A
Length:171
Mass (Da):17,996
Last modified:June 1, 2001 - v1
Checksum:iE7D10D1429D0BABF
GO
Isoform 2 (identifier: Q9DCT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC

Show »
Length:156
Mass (Da):16,330
Checksum:i5C0E7A3235E3500C
GO
Isoform 3 (identifier: Q9DCT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.

Show »
Length:137
Mass (Da):14,054
Checksum:i2E8ACD3296217841
GO
Isoform 4 (identifier: Q9DCT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: Missing.
     137-171: VTLSALNDSDANSDLVDVEGLGETPPAKKLNFDQA → SLTLDSGLLTTSADAPLLSC

Show »
Length:122
Mass (Da):12,387
Checksum:i686BA4E3F584A4DD
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02189241 – 74Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_021893137 – 171VTLSA…NFDQA → SLTLDSGLLTTSADAPLLSC in isoform 2 and isoform 4. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002491 mRNA Translation: BAB22140.1
AK003842 mRNA Translation: BAB23031.1
AK169173 mRNA Translation: BAE40952.1
AK170380 mRNA Translation: BAE41758.1
AL669869 Genomic DNA No translation available.
BC055357 mRNA Translation: AAH55357.1
CCDSiCCDS24940.1 [Q9DCT6-3]
CCDS48832.1 [Q9DCT6-4]
CCDS48833.1 [Q9DCT6-2]
CCDS48835.1 [Q9DCT6-1]
RefSeqiNP_001171072.1, NM_001177601.1
NP_001171074.1, NM_001177603.1 [Q9DCT6-2]
NP_001171077.1, NM_001177606.1 [Q9DCT6-4]
NP_001171078.1, NM_001177607.1
NP_081033.1, NM_026757.2 [Q9DCT6-3]
NP_665701.1, NM_145758.1 [Q9DCT6-1]
UniGeneiMm.30016
Mm.39265

Genome annotation databases

EnsembliENSMUST00000021181; ENSMUSP00000021181; ENSMUSG00000020831 [Q9DCT6-2]
ENSMUST00000102569; ENSMUSP00000099629; ENSMUSG00000020831 [Q9DCT6-3]
ENSMUST00000108578; ENSMUSP00000104219; ENSMUSG00000020831 [Q9DCT6-1]
ENSMUST00000108579; ENSMUSP00000104220; ENSMUSG00000020831 [Q9DCT6-4]
GeneIDi104457
KEGGimmu:104457
UCSCiuc007jud.2 mouse [Q9DCT6-2]
uc007jue.2 mouse [Q9DCT6-4]
uc007jug.2 mouse [Q9DCT6-3]
uc007juh.2 mouse [Q9DCT6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBAP18_MOUSE
AccessioniPrimary (citable) accession number: Q9DCT6
Secondary accession number(s): Q3TFE6, Q7TMP3, Q9D183
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: April 25, 2018
This is version 123 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health