Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cAMP-regulated phosphoprotein 21

Gene

Arpp21

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 2 may act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cellular response to heat Source: MGI
Complete GO annotation...

Keywords - Ligandi

Calmodulin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-regulated phosphoprotein 21
Short name:
ARPP-21
Alternative name(s):
Regulator of calmodulin signaling
Thymocyte cAMP-regulated phosphoprotein
Gene namesi
Name:Arpp21
Synonyms:Rcs, Tarpp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:107562. Arpp21.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi650 – 6501R → A: Abolishes methylation, no effect on subcellular location. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 807806cAMP-regulated phosphoprotein 21PRO_0000064683Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity
Modified residuei32 – 321PhosphoserineCombined sources
Modified residuei55 – 551Phosphoserine; by PKA2 Publications
Modified residuei133 – 1331PhosphoserineCombined sources
Modified residuei298 – 2981PhosphoserineCombined sources
Modified residuei361 – 3611PhosphoserineCombined sources
Modified residuei381 – 3811PhosphoserineBy similarity
Modified residuei557 – 5571PhosphoserineCombined sources
Modified residuei650 – 6501Omega-N-methylated arginine1 Publication
Isoform 4 (identifier: Q9DCB4-4)
Modified residuei265 – 2651PhosphoserineCombined sources

Post-translational modificationi

Phosphorylation of isoform 2 at Ser-55 is enhanced upon dopamine D1 receptor activation and favors interaction with CALM1.2 Publications
Isoform 1 is methylated by CARM1 in immature thymocytes.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ9DCB4.
PRIDEiQ9DCB4.

PTM databases

iPTMnetiQ9DCB4.
PhosphoSiteiQ9DCB4.

Expressioni

Tissue specificityi

Isoform 1 is present at high levels in thymus and low levels in brain. In thymus, isoform 1 is specifically found in immature thymocytes (at protein level).1 Publication

Inductioni

Isoform 1 is down-regulated in thymocytes upon TCR engagement (at protein level).1 Publication

Gene expression databases

BgeeiQ9DCB4.
CleanExiMM_ARPP21.
ExpressionAtlasiQ9DCB4. baseline and differential.
GenevisibleiQ9DCB4. MM.

Interactioni

Subunit structurei

Interacts with CALM1.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ9DCB4.
SMRiQ9DCB4. Positions 146-256.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini163 – 22664R3HPROSITE-ProRule annotationAdd
BLAST
Domaini227 – 29872SUZPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili32 – 5726Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi335 – 43399Ser-richAdd
BLAST
Compositional biasi502 – 749248Gln-richAdd
BLAST

Sequence similaritiesi

Contains 1 R3H domain.PROSITE-ProRule annotation
Contains 1 SUZ domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00440000038338.
HOVERGENiHBG052192.
InParanoidiQ9DCB4.
OMAiCRTNCAS.
PhylomeDBiQ9DCB4.
TreeFamiTF315915.

Family and domain databases

Gene3Di3.30.1370.50. 1 hit.
InterProiIPR001374. R3H_dom.
IPR024771. SUZ.
[Graphical view]
PfamiPF01424. R3H. 1 hit.
PF12752. SUZ. 1 hit.
[Graphical view]
SMARTiSM00393. R3H. 1 hit.
[Graphical view]
SUPFAMiSSF82708. SSF82708. 1 hit.
PROSITEiPS51061. R3H. 1 hit.
PS51673. SUZ. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DCB4-1) [UniParc]FASTAAdd to basket

Also known as: TARPP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQGGLTPT ILEEGQTEPE SAPENGILKS ESLDEEEKLE LQRRLAAQNQ
60 70 80 90 100
ERRKSKSGAG KGKLTRSLAV CEESSARSGG ESHQDQESIH LQLSSFPSLQ
110 120 130 140 150
EEDKSRKDDS EREKEKDKNR EKLSERPKIR MLSKDCSQEY TDSTGIDLHG
160 170 180 190 200
FLINTLKNNS RDRMILLKME QEMIDFIADS NNHYKKFPQM SSYQRMLVHR
210 220 230 240 250
VAAYFGLDHN VDQTGKSVII NKTSSTRIPE QRFCEHLKDE KSEESQKRFI
260 270 280 290 300
LKRDNSSIDK EDNQNRMHPF RDDRRSKSIE EREEEYQRVR ERIFAHDSVC
310 320 330 340 350
SQESLFLDNS RLQEDMHICN ETYKKRQLFR AHRDSSGRTS GSRQSSSETE
360 370 380 390 400
LRWPDHQRAW SSTDSDSSNR NLKPTMTKTA SFGGITVLTR GDSTSSTRSA
410 420 430 440 450
GKLSKTGSES SSSAGSSGSL SRTHPQSTAL TSSVAAGSPG CMAYSENGMG
460 470 480 490 500
GQVPPSSTSY ILLPLESATG IPPGSILLNP HTGQPFVNPD GTPAIYNPPG
510 520 530 540 550
SQQTLRGTVG GQPQQPPQQQ PSPQPQQQVQ ASQPQMAGPL VTQREELAAQ
560 570 580 590 600
FSQLSMSRQS SGDTPEPPSG TVYPASLLPQ TAQPQSYVIT SAGQQLSTGG
610 620 630 640 650
FSDSGPPISQ QVLQAPPSPQ GFVQQPPPAQ MSVYYYPSGQ YPTSTSQQYR
660 670 680 690 700
PLASVQYSAQ RSQQIPQTTQ QAGYQPVLSG QQGFQGMMGV QQSAHSQGVM
710 720 730 740 750
SSQQGAPVHG VMVSYPTMSS YQVPMTQGSQ AVPQQTYQPP IMLPSQAGQG
760 770 780 790 800
SLPATGMPVY CNVTPPNPQN NLRLMGPHCP SSTVPVMSAS CRTNCGNVSN

AGWQVKF
Length:807
Mass (Da):88,567
Last modified:November 13, 2007 - v2
Checksum:i99DD32A59954E139
GO
Isoform 2 (identifier: Q9DCB4-2) [UniParc]FASTAAdd to basket

Also known as: ARPP-21, RCS

The sequence of this isoform differs from the canonical sequence as follows:
     87-88: ES → TL
     89-807: Missing.

Show »
Length:88
Mass (Da):9,539
Checksum:iB9EC4A0A405C22CC
GO
Isoform 3 (identifier: Q9DCB4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-297: Missing.
     543-543: Q → QSVQSLQPSSQSVQYPAVSFPPQHLLPMSPTQHFPL

Show »
Length:809
Mass (Da):88,140
Checksum:i1932D4D307F452EA
GO
Isoform 4 (identifier: Q9DCB4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-297: Missing.
     310-329: Missing.
     543-543: Q → QSVQSLQPSSQSVQYPAVSFPPQHLLPMSPTQHFPL

Show »
Length:789
Mass (Da):85,618
Checksum:iB98D052B4608DC93
GO
Isoform 5 (identifier: Q9DCB4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-297: Missing.

Note: No experimental confirmation available.
Show »
Length:774
Mass (Da):84,296
Checksum:iD7EA63794D374082
GO
Isoform 6 (identifier: Q9DCB4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: I → M
     229-807: Missing.

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,981
Checksum:i62C0CD188B3BB448
GO
Isoform 7 (identifier: Q9DCB4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-371: SVCSQESLFL...STDSDSSNRN → VSSCFNCLLS...MCPPGHHLPG
     372-807: Missing.

Note: No experimental confirmation available.
Show »
Length:371
Mass (Da):43,129
Checksum:i1CE509029F34B491
GO
Isoform 8 (identifier: Q9DCB4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-248: PEQRFCEHLKDEKSEESQKR → VQDTGWRCKHAHRTGAVCTN
     249-807: Missing.

Note: No experimental confirmation available.
Show »
Length:248
Mass (Da):28,185
Checksum:i68EA58E94344458F
GO
Isoform 9 (identifier: Q9DCB4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-228: I → M
     229-330: Missing.
     674-703: YQPVLSGQQGFQGMMGVQQSAHSQGVMSSQ → LMIAPDTWPTVPAELALQKVTLLWISEGRW
     704-807: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):65,217
Checksum:iEF190AAB82D599B1
GO
Isoform 10 (identifier: Q9DCB4-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-282: PEQRFCEHLK...DRRSKSIEER → QFAPRKAYFW...AQIRTVPTAI
     283-807: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:282
Mass (Da):31,566
Checksum:i751A0466F6DE3F23
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti263 – 2631N → NQ in BAC26463 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei87 – 882ES → TL in isoform 2. 2 PublicationsVSP_029477
Alternative sequencei89 – 807719Missing in isoform 2. 2 PublicationsVSP_029478Add
BLAST
Alternative sequencei228 – 2281I → M in isoform 6 and isoform 9. 1 PublicationVSP_029479
Alternative sequencei229 – 807579Missing in isoform 6. 1 PublicationVSP_029480Add
BLAST
Alternative sequencei229 – 330102Missing in isoform 9. 1 PublicationVSP_029481Add
BLAST
Alternative sequencei229 – 28254PEQRF…SIEER → QFAPRKAYFWTTGLTETAQE ELPGAGRAAQRLSSGGQTTS GLGAAQIRTVPTAI in isoform 10. 1 PublicationVSP_029482Add
BLAST
Alternative sequencei229 – 24820PEQRF…ESQKR → VQDTGWRCKHAHRTGAVCTN in isoform 8. 1 PublicationVSP_029483Add
BLAST
Alternative sequencei249 – 807559Missing in isoform 8. 1 PublicationVSP_029484Add
BLAST
Alternative sequencei265 – 29733Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_029485Add
BLAST
Alternative sequencei283 – 807525Missing in isoform 10. 1 PublicationVSP_029486Add
BLAST
Alternative sequencei298 – 37174SVCSQ…SSNRN → VSSCFNCLLSMVLPSAERPL VARTEIWQGVQRLGARNELQ SRKHKCFWERTWFRDALKQS KSLCMCPPGHHLPG in isoform 7. 1 PublicationVSP_029487Add
BLAST
Alternative sequencei310 – 32920Missing in isoform 4. 1 PublicationVSP_029488Add
BLAST
Alternative sequencei372 – 807436Missing in isoform 7. 1 PublicationVSP_029489Add
BLAST
Alternative sequencei543 – 5431Q → QSVQSLQPSSQSVQYPAVSF PPQHLLPMSPTQHFPL in isoform 3 and isoform 4. 2 PublicationsVSP_029490
Alternative sequencei674 – 70330YQPVL…VMSSQ → LMIAPDTWPTVPAELALQKV TLLWISEGRW in isoform 9. 1 PublicationVSP_029491Add
BLAST
Alternative sequencei704 – 807104Missing in isoform 9. 1 PublicationVSP_029492Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF324451 mRNA. Translation: AAK48713.1.
AK002950 mRNA. No translation available.
AK029467 mRNA. Translation: BAC26463.1.
AK032417 mRNA. Translation: BAC27859.1.
AK032543 mRNA. Translation: BAC27918.1.
AK045507 mRNA. Translation: BAC32399.1.
AK050613 mRNA. Translation: BAC34343.1.
AK137974 mRNA. Translation: BAE23526.1.
BC027107 mRNA. Translation: AAH27107.1.
BC053001 mRNA. Translation: AAH53001.1.
BC128376 mRNA. No translation available.
CCDSiCCDS23587.1. [Q9DCB4-1]
CCDS40786.1. [Q9DCB4-2]
CCDS52943.1. [Q9DCB4-9]
CCDS52944.1. [Q9DCB4-4]
CCDS52945.1. [Q9DCB4-3]
CCDS52946.1. [Q9DCB4-8]
RefSeqiNP_001171086.1. NM_001177615.1. [Q9DCB4-2]
NP_001171087.1. NM_001177616.1. [Q9DCB4-4]
NP_001171088.1. NM_001177617.1.
NP_001171089.1. NM_001177618.1. [Q9DCB4-3]
NP_001171090.1. NM_001177619.1.
NP_001171091.1. NM_001177620.1. [Q9DCB4-2]
NP_001171094.1. NM_001177623.1. [Q9DCB4-8]
NP_083031.1. NM_028755.3. [Q9DCB4-2]
NP_150289.1. NM_033264.2. [Q9DCB4-1]
XP_006512407.1. XM_006512344.2. [Q9DCB4-3]
XP_006512411.1. XM_006512348.2. [Q9DCB4-1]
XP_006512413.1. XM_006512350.2. [Q9DCB4-4]
XP_006512414.1. XM_006512351.2. [Q9DCB4-5]
XP_006512424.1. XM_006512361.2. [Q9DCB4-2]
XP_006512425.1. XM_006512362.2. [Q9DCB4-2]
UniGeneiMm.297444.
Mm.487515.

Genome annotation databases

EnsembliENSMUST00000035085; ENSMUSP00000035085; ENSMUSG00000032503. [Q9DCB4-4]
ENSMUST00000070218; ENSMUSP00000069264; ENSMUSG00000032503. [Q9DCB4-3]
ENSMUST00000111872; ENSMUSP00000107503; ENSMUSG00000032503. [Q9DCB4-3]
ENSMUST00000161412; ENSMUSP00000125282; ENSMUSG00000032503. [Q9DCB4-8]
ENSMUST00000162065; ENSMUSP00000125684; ENSMUSG00000032503. [Q9DCB4-3]
ENSMUST00000162097; ENSMUSP00000124502; ENSMUSG00000032503. [Q9DCB4-1]
ENSMUST00000164754; ENSMUSP00000125862; ENSMUSG00000032503. [Q9DCB4-1]
ENSMUST00000172380; ENSMUSP00000130558; ENSMUSG00000032503. [Q9DCB4-2]
ENSMUST00000178410; ENSMUSP00000136769; ENSMUSG00000032503. [Q9DCB4-2]
GeneIDi74100.
KEGGimmu:74100.
UCSCiuc009rvx.2. mouse. [Q9DCB4-3]
uc009rvy.2. mouse. [Q9DCB4-5]
uc009rvz.2. mouse. [Q9DCB4-1]
uc009rwa.2. mouse. [Q9DCB4-4]
uc009rwc.2. mouse. [Q9DCB4-7]
uc009rwe.2. mouse. [Q9DCB4-8]
uc009rwf.1. mouse. [Q9DCB4-6]
uc009rwg.2. mouse. [Q9DCB4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF324451 mRNA. Translation: AAK48713.1.
AK002950 mRNA. No translation available.
AK029467 mRNA. Translation: BAC26463.1.
AK032417 mRNA. Translation: BAC27859.1.
AK032543 mRNA. Translation: BAC27918.1.
AK045507 mRNA. Translation: BAC32399.1.
AK050613 mRNA. Translation: BAC34343.1.
AK137974 mRNA. Translation: BAE23526.1.
BC027107 mRNA. Translation: AAH27107.1.
BC053001 mRNA. Translation: AAH53001.1.
BC128376 mRNA. No translation available.
CCDSiCCDS23587.1. [Q9DCB4-1]
CCDS40786.1. [Q9DCB4-2]
CCDS52943.1. [Q9DCB4-9]
CCDS52944.1. [Q9DCB4-4]
CCDS52945.1. [Q9DCB4-3]
CCDS52946.1. [Q9DCB4-8]
RefSeqiNP_001171086.1. NM_001177615.1. [Q9DCB4-2]
NP_001171087.1. NM_001177616.1. [Q9DCB4-4]
NP_001171088.1. NM_001177617.1.
NP_001171089.1. NM_001177618.1. [Q9DCB4-3]
NP_001171090.1. NM_001177619.1.
NP_001171091.1. NM_001177620.1. [Q9DCB4-2]
NP_001171094.1. NM_001177623.1. [Q9DCB4-8]
NP_083031.1. NM_028755.3. [Q9DCB4-2]
NP_150289.1. NM_033264.2. [Q9DCB4-1]
XP_006512407.1. XM_006512344.2. [Q9DCB4-3]
XP_006512411.1. XM_006512348.2. [Q9DCB4-1]
XP_006512413.1. XM_006512350.2. [Q9DCB4-4]
XP_006512414.1. XM_006512351.2. [Q9DCB4-5]
XP_006512424.1. XM_006512361.2. [Q9DCB4-2]
XP_006512425.1. XM_006512362.2. [Q9DCB4-2]
UniGeneiMm.297444.
Mm.487515.

3D structure databases

ProteinModelPortaliQ9DCB4.
SMRiQ9DCB4. Positions 146-256.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ9DCB4.
PhosphoSiteiQ9DCB4.

Proteomic databases

MaxQBiQ9DCB4.
PRIDEiQ9DCB4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000035085; ENSMUSP00000035085; ENSMUSG00000032503. [Q9DCB4-4]
ENSMUST00000070218; ENSMUSP00000069264; ENSMUSG00000032503. [Q9DCB4-3]
ENSMUST00000111872; ENSMUSP00000107503; ENSMUSG00000032503. [Q9DCB4-3]
ENSMUST00000161412; ENSMUSP00000125282; ENSMUSG00000032503. [Q9DCB4-8]
ENSMUST00000162065; ENSMUSP00000125684; ENSMUSG00000032503. [Q9DCB4-3]
ENSMUST00000162097; ENSMUSP00000124502; ENSMUSG00000032503. [Q9DCB4-1]
ENSMUST00000164754; ENSMUSP00000125862; ENSMUSG00000032503. [Q9DCB4-1]
ENSMUST00000172380; ENSMUSP00000130558; ENSMUSG00000032503. [Q9DCB4-2]
ENSMUST00000178410; ENSMUSP00000136769; ENSMUSG00000032503. [Q9DCB4-2]
GeneIDi74100.
KEGGimmu:74100.
UCSCiuc009rvx.2. mouse. [Q9DCB4-3]
uc009rvy.2. mouse. [Q9DCB4-5]
uc009rvz.2. mouse. [Q9DCB4-1]
uc009rwa.2. mouse. [Q9DCB4-4]
uc009rwc.2. mouse. [Q9DCB4-7]
uc009rwe.2. mouse. [Q9DCB4-8]
uc009rwf.1. mouse. [Q9DCB4-6]
uc009rwg.2. mouse. [Q9DCB4-2]

Organism-specific databases

CTDi10777.
MGIiMGI:107562. Arpp21.

Phylogenomic databases

GeneTreeiENSGT00440000038338.
HOVERGENiHBG052192.
InParanoidiQ9DCB4.
OMAiCRTNCAS.
PhylomeDBiQ9DCB4.
TreeFamiTF315915.

Miscellaneous databases

ChiTaRSiArpp21. mouse.
NextBioi339769.
PROiQ9DCB4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9DCB4.
CleanExiMM_ARPP21.
ExpressionAtlasiQ9DCB4. baseline and differential.
GenevisibleiQ9DCB4. MM.

Family and domain databases

Gene3Di3.30.1370.50. 1 hit.
InterProiIPR001374. R3H_dom.
IPR024771. SUZ.
[Graphical view]
PfamiPF01424. R3H. 1 hit.
PF12752. SUZ. 1 hit.
[Graphical view]
SMARTiSM00393. R3H. 1 hit.
[Graphical view]
SUPFAMiSSF82708. SSF82708. 1 hit.
PROSITEiPS51061. R3H. 1 hit.
PS51673. SUZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "TARPP, a novel protein that accompanies TCR gene rearrangement and thymocyte education."
    Kisielow J., Nairn A.C., Karjalainen K.
    Eur. J. Immunol. 31:1141-1149(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION, SUBCELLULAR LOCATION.
    Tissue: Thymus.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4; 6; 7; 8 AND 9), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4-807 (ISOFORM 5).
    Strain: C57BL/6J.
    Tissue: Brain, Corpora quadrigemina, Head, Olfactory bulb and Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 10).
    Strain: C57BL/6J.
    Tissue: Brain and Retina.
  4. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 55-61 AND 201-227, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.
  5. "Drugs of abuse modulate the phosphorylation of ARPP-21, a cyclic AMP-regulated phosphoprotein enriched in the basal ganglia."
    Caporaso G.L., Bibb J.A., Snyder G.L., Valle C., Rakhilin S., Fienberg A.A., Hemmings H.C. Jr., Nairn A.C., Greengard P.
    Neuropharmacology 39:1637-1644(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-55.
  6. "Loss of CARM1 results in hypomethylation of thymocyte cyclic AMP-regulated phosphoprotein and deregulated early T cell development."
    Kim J., Lee J., Yadav N., Wu Q., Carter C., Richard S., Richie E., Bedford M.T.
    J. Biol. Chem. 279:25339-25344(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: METHYLATION AT ARG-650, MUTAGENESIS OF ARG-650, SUBCELLULAR LOCATION.
  7. "A network of control mediated by regulator of calcium/calmodulin-dependent signaling."
    Rakhilin S.V., Olson P.A., Nishi A., Starkova N.N., Fienberg A.A., Nairn A.C., Surmeier D.J., Greengard P.
    Science 306:698-701(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CALM1, FUNCTION, PHOSPHORYLATION AT SER-55.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-32; SER-133; SER-298; SER-361 AND SER-557, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-265 (ISOFORM 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain and Lung.

Entry informationi

Entry nameiARP21_MOUSE
AccessioniPrimary (citable) accession number: Q9DCB4
Secondary accession number(s): A1A561
, Q3UUU8, Q7TS83, Q8BLD1, Q8BWM1, Q8C018, Q8C038, Q8C0Y6, Q91Y59
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: November 13, 2007
Last modified: January 20, 2016
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.