Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High mobility group protein 20A

Gene

Hmg20a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in neuronal differentiation as chromatin-associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase KMT2A/MLL1 and consequent increased methylation of histone H3 lysine 4.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi102 – 17069HMG boxPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: MGI

GO - Biological processi

  • chromatin modification Source: MGI
  • negative regulation of neuron differentiation Source: MGI
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
High mobility group protein 20A
Alternative name(s):
HMG box-containing protein 20A
HMG domain-containing protein HMGX1
Inhibitor of BRAF35
Short name:
iBRAF
Gene namesi
Name:Hmg20a
Synonyms:Ibraf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1914117. Hmg20a.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 346346High mobility group protein 20APRO_0000238650Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei104 – 1041PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9DC33.
MaxQBiQ9DC33.
PaxDbiQ9DC33.
PeptideAtlasiQ9DC33.
PRIDEiQ9DC33.

PTM databases

iPTMnetiQ9DC33.
PhosphoSiteiQ9DC33.

Expressioni

Tissue specificityi

Expressed in brain. Detected in mature neurons.1 Publication

Developmental stagei

Detected at E16.5 in the outer cortex of the developing brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000032329.
CleanExiMM_HMG20A.
GenevisibleiQ9DC33. MM.

Interactioni

GO - Molecular functioni

  • protein heterodimerization activity Source: MGI

Protein-protein interaction databases

BioGridi211774. 3 interactions.
IntActiQ9DC33. 2 interactions.
MINTiMINT-4128465.
STRINGi10090.ENSMUSP00000034879.

Structurei

3D structure databases

ProteinModelPortaliQ9DC33.
SMRiQ9DC33. Positions 99-177.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili228 – 27245Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 HMG box DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0381. Eukaryota.
COG5648. LUCA.
GeneTreeiENSGT00730000110938.
HOVERGENiHBG059870.
InParanoidiQ9DC33.
OMAiTTGLTHP.
OrthoDBiEOG091G0IHZ.
PhylomeDBiQ9DC33.
TreeFamiTF106440.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
InterProiIPR009071. HMG_box_dom.
[Graphical view]
PfamiPF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DC33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESLMASSTL PPLFADEDGS KESNDLATSG LTHPEGPYGS AATSTTNPEF
60 70 80 90 100
VEDLSQGQLL QSEASNAVEG NEQRPEDEQR SKRGGWSKGR KRKKPLRDSN
110 120 130 140 150
APKSPLTGYV RFMNERREQL RAKRPEVPFP EITRMLGNEW SKLPPEEKQR
160 170 180 190 200
YLDEADRDKE RYMKELEQYQ KTEAYKVFSR KTQDRQKGKS HRQDAARQAT
210 220 230 240 250
HDHEKETEVK ERSVFDIPIF TEEFLNHSKA REAELRQLRK SNMEFEERNA
260 270 280 290 300
ALQKHVESMR TAVEKLEVDV IQERSRNTVL QQHLETLRQM LTSSFASMPL
310 320 330 340
PGSGEIPTVD TIDSYMNRLH SIILANPQDN ENFIATVREV VNRLDR
Length:346
Mass (Da):39,917
Last modified:June 1, 2001 - v1
Checksum:iD57502BEFD3C0026
GO
Isoform 2 (identifier: Q9DC33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-346: SGEIPTVDTI...VREVVNRLDR → NVILSEVSGR...SVSSRPACPT

Show »
Length:379
Mass (Da):43,335
Checksum:i3053980DC8BA7DE7
GO
Isoform 3 (identifier: Q9DC33-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-180: RYLDEADRDKERYMKELEQYQKTEAYKVFSR → VMVPASGVSLGFDYISQIVWGAGEIWGLGHA
     181-346: Missing.

Show »
Length:180
Mass (Da):19,843
Checksum:iE176D4DD46271E60
GO
Isoform 4 (identifier: Q9DC33-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-101: QRSKRGGWSKGRKRKKPLRDSNA → VSEHLLSLSTAASKAMGMQGGIE
     102-346: Missing.

Show »
Length:101
Mass (Da):10,514
Checksum:iAB97522B12E4508E
GO

Sequence cautioni

The sequence ABA26278 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti294 – 2941S → C in BAC30283 (PubMed:16141072).Curated
Sequence conflicti301 – 3011P → T in BAB30892 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei79 – 10123QRSKR…RDSNA → VSEHLLSLSTAASKAMGMQG GIE in isoform 4. 1 PublicationVSP_018623Add
BLAST
Alternative sequencei102 – 346245Missing in isoform 4. 1 PublicationVSP_018624Add
BLAST
Alternative sequencei150 – 18031RYLDE…KVFSR → VMVPASGVSLGFDYISQIVW GAGEIWGLGHA in isoform 3. 1 PublicationVSP_018625Add
BLAST
Alternative sequencei181 – 346166Missing in isoform 3. 1 PublicationVSP_018626Add
BLAST
Alternative sequencei303 – 34644SGEIP…NRLDR → NVILSEVSGRESGEDGDGVL FTLVLMWRSRSVSQEEKRRG KKNPVKIFSAVWACLKSQHS GGRGRKISVSSRPACPT in isoform 2. 2 PublicationsVSP_018627Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ182735 mRNA. Translation: ABA26278.1. Different initiation.
AK004596 mRNA. Translation: BAB23397.1.
AK017716 mRNA. Translation: BAB30892.1.
AK032790 mRNA. Translation: BAC28023.1.
AK039222 mRNA. Translation: BAC30283.1.
AK086346 mRNA. Translation: BAC39652.1.
AK134213 mRNA. Translation: BAE22054.1.
BC013804 mRNA. Translation: AAH13804.1.
BC068257 mRNA. Translation: AAH68257.1.
CCDSiCCDS23208.1. [Q9DC33-1]
RefSeqiNP_080088.1. NM_025812.2. [Q9DC33-1]
XP_006511431.1. XM_006511368.2. [Q9DC33-2]
UniGeneiMm.150856.

Genome annotation databases

EnsembliENSMUST00000034879; ENSMUSP00000034879; ENSMUSG00000032329. [Q9DC33-1]
GeneIDi66867.
KEGGimmu:66867.
UCSCiuc009ptb.1. mouse. [Q9DC33-4]
uc009ptc.1. mouse. [Q9DC33-3]
uc009ptd.1. mouse. [Q9DC33-2]
uc009pte.1. mouse. [Q9DC33-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ182735 mRNA. Translation: ABA26278.1. Different initiation.
AK004596 mRNA. Translation: BAB23397.1.
AK017716 mRNA. Translation: BAB30892.1.
AK032790 mRNA. Translation: BAC28023.1.
AK039222 mRNA. Translation: BAC30283.1.
AK086346 mRNA. Translation: BAC39652.1.
AK134213 mRNA. Translation: BAE22054.1.
BC013804 mRNA. Translation: AAH13804.1.
BC068257 mRNA. Translation: AAH68257.1.
CCDSiCCDS23208.1. [Q9DC33-1]
RefSeqiNP_080088.1. NM_025812.2. [Q9DC33-1]
XP_006511431.1. XM_006511368.2. [Q9DC33-2]
UniGeneiMm.150856.

3D structure databases

ProteinModelPortaliQ9DC33.
SMRiQ9DC33. Positions 99-177.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi211774. 3 interactions.
IntActiQ9DC33. 2 interactions.
MINTiMINT-4128465.
STRINGi10090.ENSMUSP00000034879.

PTM databases

iPTMnetiQ9DC33.
PhosphoSiteiQ9DC33.

Proteomic databases

EPDiQ9DC33.
MaxQBiQ9DC33.
PaxDbiQ9DC33.
PeptideAtlasiQ9DC33.
PRIDEiQ9DC33.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034879; ENSMUSP00000034879; ENSMUSG00000032329. [Q9DC33-1]
GeneIDi66867.
KEGGimmu:66867.
UCSCiuc009ptb.1. mouse. [Q9DC33-4]
uc009ptc.1. mouse. [Q9DC33-3]
uc009ptd.1. mouse. [Q9DC33-2]
uc009pte.1. mouse. [Q9DC33-1]

Organism-specific databases

CTDi10363.
MGIiMGI:1914117. Hmg20a.

Phylogenomic databases

eggNOGiKOG0381. Eukaryota.
COG5648. LUCA.
GeneTreeiENSGT00730000110938.
HOVERGENiHBG059870.
InParanoidiQ9DC33.
OMAiTTGLTHP.
OrthoDBiEOG091G0IHZ.
PhylomeDBiQ9DC33.
TreeFamiTF106440.

Miscellaneous databases

ChiTaRSiHmg20a. mouse.
PROiQ9DC33.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000032329.
CleanExiMM_HMG20A.
GenevisibleiQ9DC33. MM.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
InterProiIPR009071. HMG_box_dom.
[Graphical view]
PfamiPF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHM20A_MOUSE
AccessioniPrimary (citable) accession number: Q9DC33
Secondary accession number(s): Q3LSF9
, Q6NV87, Q8BSK1, Q8C3C1, Q8CAA0, Q9CYG2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: June 1, 2001
Last modified: September 7, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.