Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of G-protein signaling 3

Gene

Rgs3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.2 Publications

GO - Molecular functioni

  • GTPase activator activity Source: MGI

GO - Biological processi

  • G-protein coupled receptor signaling pathway Source: MGI
  • negative regulation of signal transduction Source: UniProtKB-KW
  • positive regulation of GTPase activity Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Signal transduction inhibitor

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGS3
Alternative name(s):
C2PA
Gene namesi
Name:Rgs3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1354734. Rgs3.

Subcellular locationi

  • Cytoplasm Curated
  • Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

  • Note: Long isoforms are cytoplasmic and associated with the plasma membrane. Short isoforms are nuclear.By similarity
Isoform 2 :
  • Cytoplasm 1 Publication
Isoform 3 :
Isoform 4 :

GO - Cellular componenti

  • cytoplasm Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 966966Regulator of G-protein signaling 3PRO_0000204183Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei712 – 7121PhosphoserineCombined sources
Modified residuei715 – 7151PhosphoserineCombined sources
Modified residuei747 – 7471PhosphoserineCombined sources
Modified residuei776 – 7761PhosphoserineCombined sources

Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
ISGylated.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9DC04.
MaxQBiQ9DC04.
PaxDbiQ9DC04.
PRIDEiQ9DC04.

PTM databases

iPTMnetiQ9DC04.
PhosphoSiteiQ9DC04.

Expressioni

Tissue specificityi

Detected in embryos from E8.5-16.5 in cortical ventricular zone, dorsal root ganglia and cerebellar primordia. Isoform 3 is detected in testis and in spermatocytes from newborn mice. Levels increase and reach a maximum after 21 days; after this they decrease again. Long isoforms are widely expressed.1 Publication

Gene expression databases

BgeeiQ9DC04.
CleanExiMM_RGS3.
ExpressionAtlasiQ9DC04. baseline and differential.
GenevisibleiQ9DC04. MM.

Interactioni

Subunit structurei

Binds the GNB1-GNG2 heterodimer (By similarity). Binds EFNB1 and EFNB2.By similarity

Protein-protein interaction databases

BioGridi206112. 2 interactions.
IntActiQ9DC04. 1 interaction.
MINTiMINT-152808.
STRINGi10090.ENSMUSP00000081569.

Structurei

Secondary structure

1
966
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi18 – 225Combined sources
Beta strandi25 – 295Combined sources
Beta strandi35 – 373Combined sources
Helixi48 – 525Combined sources
Beta strandi59 – 635Combined sources
Helixi73 – 8210Combined sources
Beta strandi84 – 9310Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WHDNMR-A18-94[»]
ProteinModelPortaliQ9DC04.
SMRiQ9DC04. Positions 15-95, 832-958.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9DC04.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini18 – 9578PDZPROSITE-ProRule annotationAdd
BLAST
Domaini841 – 966126RGSPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi417 – 574158Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 RGS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3589. Eukaryota.
ENOG410YMJD. LUCA.
GeneTreeiENSGT00760000118903.
HOVERGENiHBG013233.
InParanoidiQ9DC04.
KOiK07524.
OMAiWNRAGDS.
OrthoDBiEOG7VHSZ5.
PhylomeDBiQ9DC04.
TreeFamiTF351952.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
IPR011993. PH_dom-like.
IPR016137. RGS.
IPR024066. RGS_subdom1.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9DC04-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRFNGLCKV CSERRYRQIT IRRGKDGFGF TICCDSPVRV QAVDSGGPAE
60 70 80 90 100
RAGLQQLDTV LQLNERPVEH WKCVELAHEI RSCPSEIILL VWRVVPQIKP
110 120 130 140 150
GPDGGVLRRA SCKSTHDLLS PPNKREKNCT HGAPVRPEQR HSCHLVCDSS
160 170 180 190 200
DGLLLGGWER YTEVGKRSGQ HTLPALSRTT TPTDPNYIIL APLNPGSQLL
210 220 230 240 250
RPVYQEDTIP EEPGTTTKGK SYTGLGKKSR LMKTVQTMKG HSNYQDCSAL
260 270 280 290 300
RPHIPHSSYG TYVTLAPKVL VFPVFVQPLD LCNPARTLLL SEELLLYEGR
310 320 330 340 350
NKTSQVTLFA YSDLLLFTKE EEPGRCDVLR NPLYLQSVKL QEGSSEDLKF
360 370 380 390 400
CVLYLAEKAE CLFTLEAHSQ EQKKRVCWCL SENIAKQQQL AAPPTERKMF
410 420 430 440 450
ETEADEKEMP LVEGKGPGAE EPAPSKNPSP GQELPPGQDL PPSKDPSPSQ
460 470 480 490 500
ELPAGQDLPP SKDPSPSQEL PAGQDLPPSK DPSPSQELPV GQDLPPRKDS
510 520 530 540 550
SGQEAAPGPE SPSSEDIATC PKPPQSPETS TSKDSPPGQG SSPTTELPSC
560 570 580 590 600
QGLPAGQEST SQDPLLSQEP PVIPESSASV QKRLPSQESP SSLGSLPEKD
610 620 630 640 650
LAEQTISSGE PPVATGAVLP ASRPNFVIPE VRLDNAYSQL DGAHGGSSGE
660 670 680 690 700
DEDAEEGEEG GEGEEDEEDD TSDDNYGDRS EAKRSSLIET GQGAEGGFSL
710 720 730 740 750
RVQNSLRRRT HSEGSLLQES RGPCFASDTT LHCSDGEGAT STWAIPSPRT
760 770 780 790 800
LKKELGRNGG SMHHLSLFFT GHRKMSGTDL TECDEASRKR KSKNIAKDMK
810 820 830 840 850
NKLAIFRRRN ESPGAQPASK TDKTTKSFKP TSEEALKWSE SLEKLLLHKY
860 870 880 890 900
GLEVFQAFLR TEFSEENLEF WLACEDFKKV KSQSKMAAKA KKIFAEFIAI
910 920 930 940 950
QACKEVNLDS YTREHTKENL QSITRGCFDL AQKRIFGLME KDSYPRFLRS
960
DLYLDLINQK KMSPPL
Length:966
Mass (Da):106,219
Last modified:June 7, 2005 - v2
Checksum:i20B6B2BB7A9C8BB2
GO
Isoform 5 (identifier: Q9DC04-1) [UniParc]FASTAAdd to basket

Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.

Show »
Length:568
Mass (Da):61,559
Checksum:i91939E22F3DA9F5C
GO
Isoform 6 (identifier: Q9DC04-2) [UniParc]FASTAAdd to basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     399-773: Missing.
     774-795: KMSGTDLTECDEASRKRKSKNI → MLRGMYLTRNGNLQRRHTMKE

Show »
Length:590
Mass (Da):67,161
Checksum:iED8AACB256F455BA
GO
Isoform 2 (identifier: Q9DC04-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     455-490: Missing.

Show »
Length:930
Mass (Da):102,501
Checksum:i0D407C93459F3B7F
GO
Isoform 3 (identifier: Q9DC04-5) [UniParc]FASTAAdd to basket

Also known as: C2PA

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MNRFNGLCKVCSERRYR → MERPHQDASL...EGDPENGEKL
     399-433: MFETEADEKEMPLVEGKGPGAEEPAPSKNPSPGQE → KLHPYGSLQQEMGPVTSISATQDRSFTSSGQTLIG
     434-966: Missing.

Note: Nuclear.1 Publication
Show »
Length:610
Mass (Da):68,468
Checksum:iDAD60727CD56056F
GO
Isoform 4 (identifier: Q9DC04-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     399-433: MFETEADEKEMPLVEGKGPGAEEPAPSKNPSPGQE → KLHPYGSLQQEMGPVTSISATQDRSFTSSGQTLIG
     434-966: Missing.

Show »
Length:433
Mass (Da):48,383
Checksum:i1347D9311876B525
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti179 – 1791T → A in AAL37173 (Ref. 3) Curated
Sequence conflicti501 – 5011S → P in AAK38878 (PubMed:11034339).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 398398Missing in isoform 5. 2 PublicationsVSP_013966Add
BLAST
Alternative sequencei1 – 1717MNRFN…ERRYR → MERPHQDASLSKKDACTQTY PPRRRIRHAQVQDAGQLKLS IDAQDRVLLPHIIEGKGLMS REPGICDPYVKVSLIPEDSQ LPCQTTQIIPDCRDPAFHEH FFFPVPEEGDQKRLLVTVWN RASETRQHTLIGCMSFGVRS LLTPDKEISGWYYLLGEDLG RTKHLKVARRRLQPLRDMLL RMPGEGDPENGEKL in isoform 3. 1 PublicationVSP_013967Add
BLAST
Alternative sequencei399 – 773375Missing in isoform 6. CuratedVSP_005663Add
BLAST
Alternative sequencei399 – 43335MFETE…SPGQE → KLHPYGSLQQEMGPVTSISA TQDRSFTSSGQTLIG in isoform 3 and isoform 4. 3 PublicationsVSP_013968Add
BLAST
Alternative sequencei434 – 966533Missing in isoform 3 and isoform 4. 3 PublicationsVSP_013969Add
BLAST
Alternative sequencei455 – 49036Missing in isoform 2. 1 PublicationVSP_013970Add
BLAST
Alternative sequencei774 – 79522KMSGT…KSKNI → MLRGMYLTRNGNLQRRHTMK E in isoform 6. CuratedVSP_005664Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250999 mRNA. Translation: CAB66146.1.
AF350047 mRNA. Translation: AAK38878.1.
AF319519 mRNA. Translation: AAL37173.1.
AK004648 mRNA. Translation: BAB23439.1.
AK028445 mRNA. Translation: BAC25954.1.
AL672272 Genomic DNA. Translation: CAI25817.1.
AL672272 Genomic DNA. Translation: CAI25819.1.
AL672272 Genomic DNA. Translation: CAI25820.1.
AL672272 Genomic DNA. Translation: CAI25824.1.
BC033449 mRNA. Translation: AAH33449.1.
AF215670 mRNA. Translation: AAF34627.1.
AF215669 mRNA. Translation: AAF34626.1.
CCDSiCCDS18246.1. [Q9DC04-5]
CCDS38776.1. [Q9DC04-6]
CCDS51202.1. [Q9DC04-3]
CCDS80110.1. [Q9DC04-1]
RefSeqiNP_001075119.1. NM_001081650.2. [Q9DC04-6]
NP_001297635.1. NM_001310706.1. [Q9DC04-1]
NP_062365.2. NM_019492.3.
NP_599018.3. NM_134257.3. [Q9DC04-3]
XP_006538130.1. XM_006538067.2. [Q9DC04-1]
XP_006538131.1. XM_006538068.2. [Q9DC04-1]
XP_006538132.1. XM_006538069.2. [Q9DC04-1]
XP_006538133.1. XM_006538070.2. [Q9DC04-1]
UniGeneiMm.286753.
Mm.350679.

Genome annotation databases

EnsembliENSMUST00000084521; ENSMUSP00000081569; ENSMUSG00000059810. [Q9DC04-3]
ENSMUST00000107420; ENSMUSP00000103043; ENSMUSG00000059810. [Q9DC04-1]
ENSMUST00000107424; ENSMUSP00000103047; ENSMUSG00000059810. [Q9DC04-6]
GeneIDi50780.
KEGGimmu:50780.
UCSCiuc008tfe.2. mouse. [Q9DC04-6]
uc008tfg.1. mouse. [Q9DC04-1]
uc008tfh.2. mouse. [Q9DC04-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250999 mRNA. Translation: CAB66146.1.
AF350047 mRNA. Translation: AAK38878.1.
AF319519 mRNA. Translation: AAL37173.1.
AK004648 mRNA. Translation: BAB23439.1.
AK028445 mRNA. Translation: BAC25954.1.
AL672272 Genomic DNA. Translation: CAI25817.1.
AL672272 Genomic DNA. Translation: CAI25819.1.
AL672272 Genomic DNA. Translation: CAI25820.1.
AL672272 Genomic DNA. Translation: CAI25824.1.
BC033449 mRNA. Translation: AAH33449.1.
AF215670 mRNA. Translation: AAF34627.1.
AF215669 mRNA. Translation: AAF34626.1.
CCDSiCCDS18246.1. [Q9DC04-5]
CCDS38776.1. [Q9DC04-6]
CCDS51202.1. [Q9DC04-3]
CCDS80110.1. [Q9DC04-1]
RefSeqiNP_001075119.1. NM_001081650.2. [Q9DC04-6]
NP_001297635.1. NM_001310706.1. [Q9DC04-1]
NP_062365.2. NM_019492.3.
NP_599018.3. NM_134257.3. [Q9DC04-3]
XP_006538130.1. XM_006538067.2. [Q9DC04-1]
XP_006538131.1. XM_006538068.2. [Q9DC04-1]
XP_006538132.1. XM_006538069.2. [Q9DC04-1]
XP_006538133.1. XM_006538070.2. [Q9DC04-1]
UniGeneiMm.286753.
Mm.350679.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1WHDNMR-A18-94[»]
ProteinModelPortaliQ9DC04.
SMRiQ9DC04. Positions 15-95, 832-958.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206112. 2 interactions.
IntActiQ9DC04. 1 interaction.
MINTiMINT-152808.
STRINGi10090.ENSMUSP00000081569.

PTM databases

iPTMnetiQ9DC04.
PhosphoSiteiQ9DC04.

Proteomic databases

EPDiQ9DC04.
MaxQBiQ9DC04.
PaxDbiQ9DC04.
PRIDEiQ9DC04.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000084521; ENSMUSP00000081569; ENSMUSG00000059810. [Q9DC04-3]
ENSMUST00000107420; ENSMUSP00000103043; ENSMUSG00000059810. [Q9DC04-1]
ENSMUST00000107424; ENSMUSP00000103047; ENSMUSG00000059810. [Q9DC04-6]
GeneIDi50780.
KEGGimmu:50780.
UCSCiuc008tfe.2. mouse. [Q9DC04-6]
uc008tfg.1. mouse. [Q9DC04-1]
uc008tfh.2. mouse. [Q9DC04-3]

Organism-specific databases

CTDi5998.
MGIiMGI:1354734. Rgs3.

Phylogenomic databases

eggNOGiKOG3589. Eukaryota.
ENOG410YMJD. LUCA.
GeneTreeiENSGT00760000118903.
HOVERGENiHBG013233.
InParanoidiQ9DC04.
KOiK07524.
OMAiWNRAGDS.
OrthoDBiEOG7VHSZ5.
PhylomeDBiQ9DC04.
TreeFamiTF351952.

Miscellaneous databases

ChiTaRSiRgs3. mouse.
EvolutionaryTraceiQ9DC04.
NextBioi307725.
PROiQ9DC04.
SOURCEiSearch...

Gene expression databases

BgeeiQ9DC04.
CleanExiMM_RGS3.
ExpressionAtlasiQ9DC04. baseline and differential.
GenevisibleiQ9DC04. MM.

Family and domain databases

Gene3Di1.10.196.10. 2 hits.
2.30.29.30. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
IPR011993. PH_dom-like.
IPR016137. RGS.
IPR024066. RGS_subdom1.
[Graphical view]
PfamiPF00595. PDZ. 1 hit.
PF00615. RGS. 1 hit.
[Graphical view]
PRINTSiPR01301. RGSPROTEIN.
SMARTiSM00228. PDZ. 1 hit.
SM00315. RGS. 1 hit.
[Graphical view]
SUPFAMiSSF48097. SSF48097. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50106. PDZ. 1 hit.
PS50132. RGS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "C2PA, a new protein expressed during mouse spermatogenesis."
    Linares J.-L., Wendling C., Tomasetto C., Rio M.-C.
    FEBS Lett. 480:249-254(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "Ephrin-B reverse signaling is mediated by a novel PDZ-RGS protein and selectively inhibits G protein-coupled chemoattraction."
    Lu Q., Sun E.E., Klein R.S., Flanagan J.G.
    Cell 105:69-79(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH EPHRINS, SUBCELLULAR LOCATION.
    Tissue: Embryo.
  3. "EPP1, a novel PDZ protein expressed in the arterial endothelial cells binding to B ephrins."
    Huang W.-Y., Izumo S.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
    Strain: C57BL/6J.
    Tissue: Lung.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Strain: FVB/N.
    Tissue: Mammary gland.
  7. "RGS molecule expression in murine B lymphocytes and ability to down-regulate chemotaxis to lymphoid chemokines."
    Reif K., Cyster J.G.
    J. Immunol. 164:4720-4729(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE (ISOFORMS 5 AND 6).
    Strain: C57BL/6J.
    Tissue: Embryo.
  8. "C2PA is a nuclear protein implicated in the heat shock response."
    Hirabayashi S., Ohno H., Iida J., Hata Y.
    J. Cell. Biochem. 87:65-74(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-712; SER-715; SER-747 AND SER-776, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Lung, Spleen and Testis.
  10. "Solution structure of the PDZ domain of RGS3."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 10-94.

Entry informationi

Entry nameiRGS3_MOUSE
AccessioniPrimary (citable) accession number: Q9DC04
Secondary accession number(s): Q5SRB1
, Q5SRB4, Q5SRB8, Q8CEE3, Q8VI25, Q925G9, Q9JL22, Q9JL23, Q9QXA2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: June 7, 2005
Last modified: March 16, 2016
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.