Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9D8P4

- RM17_MOUSE

UniProt

Q9D8P4 - RM17_MOUSE

Protein

39S ribosomal protein L17, mitochondrial

Gene

Mrpl17

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. structural constituent of ribosome Source: MGI

    GO - Biological processi

    1. mitochondrial genome maintenance Source: MGI
    2. translation Source: MGI

    Keywords - Molecular functioni

    Ribonucleoprotein, Ribosomal protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    39S ribosomal protein L17, mitochondrial
    Short name:
    L17mt
    Short name:
    MRP-L17
    Gene namesi
    Name:Mrpl17
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 7

    Organism-specific databases

    MGIiMGI:1351608. Mrpl17.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrial inner membrane Source: MGI
    2. mitochondrial large ribosomal subunit Source: MGI
    3. mitochondrion Source: MGI

    Keywords - Cellular componenti

    Mitochondrion

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 88MitochondrionBy similarity
    Chaini9 – 17616839S ribosomal protein L17, mitochondrialPRO_0000237332Add
    BLAST

    Proteomic databases

    PaxDbiQ9D8P4.
    PRIDEiQ9D8P4.

    PTM databases

    PhosphoSiteiQ9D8P4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9D8P4.
    BgeeiQ9D8P4.
    CleanExiMM_MRPL17.
    GenevestigatoriQ9D8P4.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9D8P4.
    SMRiQ9D8P4. Positions 9-128.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ribosomal protein L17P family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0203.
    GeneTreeiENSGT00390000010698.
    HOGENOMiHOG000019780.
    HOVERGENiHBG056029.
    InParanoidiQ9D8P4.
    KOiK02879.
    OMAiGDTDEKA.
    OrthoDBiEOG74TX11.
    PhylomeDBiQ9D8P4.
    TreeFamiTF105844.

    Family and domain databases

    Gene3Di3.90.1030.10. 1 hit.
    InterProiIPR000456. Ribosomal_L17.
    [Graphical view]
    PANTHERiPTHR14413. PTHR14413. 1 hit.
    PfamiPF01196. Ribosomal_L17. 1 hit.
    [Graphical view]
    SUPFAMiSSF64263. SSF64263. 1 hit.
    TIGRFAMsiTIGR00059. L17. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9D8P4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRLSLAAAIS HGRVYRRLGL GPESRIHLLR NLLTGLVRHE RIEATWARAD    50
    EMRGYAEKLI DYGKLGDTNE RAMRMADFWL TEKDLIPKLF KVLAPRFQGQ 100
    NGNYTRMLQI PNRKEQDRAK MAVIEYKGNY LPPLPLPHRD SNLTLLNQLL 150
    LGLQQDLHHN QDASLHSSCT VQTPKT 176
    Length:176
    Mass (Da):20,249
    Last modified:June 1, 2001 - v1
    Checksum:i3A0CBC71740A4E42
    GO
    Isoform 2 (identifier: Q9D8P4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         82-116: EKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQ → VSAPYLLVRKESLENRVPGRLKAGHSFMYQTCELP
         117-176: Missing.

    Show »
    Length:116
    Mass (Da):13,340
    Checksum:i9627DA824FA17466
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei82 – 11635EKDLI…NRKEQ → VSAPYLLVRKESLENRVPGR LKAGHSFMYQTCELP in isoform 2. 1 PublicationVSP_018590Add
    BLAST
    Alternative sequencei117 – 17660Missing in isoform 2. 1 PublicationVSP_018591Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK007828 mRNA. Translation: BAB25288.1.
    AK144092 mRNA. Translation: BAE25695.1.
    AK147957 mRNA. Translation: BAE28251.1.
    BC010718 mRNA. Translation: AAH10718.1.
    CCDSiCCDS21662.1. [Q9D8P4-1]
    RefSeqiNP_079577.1. NM_025301.2. [Q9D8P4-1]
    UniGeneiMm.44225.

    Genome annotation databases

    EnsembliENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879. [Q9D8P4-1]
    GeneIDi27397.
    KEGGimmu:27397.
    UCSCiuc009izl.1. mouse. [Q9D8P4-1]
    uc009izm.1. mouse. [Q9D8P4-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK007828 mRNA. Translation: BAB25288.1 .
    AK144092 mRNA. Translation: BAE25695.1 .
    AK147957 mRNA. Translation: BAE28251.1 .
    BC010718 mRNA. Translation: AAH10718.1 .
    CCDSi CCDS21662.1. [Q9D8P4-1 ]
    RefSeqi NP_079577.1. NM_025301.2. [Q9D8P4-1 ]
    UniGenei Mm.44225.

    3D structure databases

    ProteinModelPortali Q9D8P4.
    SMRi Q9D8P4. Positions 9-128.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q9D8P4.

    Proteomic databases

    PaxDbi Q9D8P4.
    PRIDEi Q9D8P4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000124482 ; ENSMUSP00000117971 ; ENSMUSG00000030879 . [Q9D8P4-1 ]
    GeneIDi 27397.
    KEGGi mmu:27397.
    UCSCi uc009izl.1. mouse. [Q9D8P4-1 ]
    uc009izm.1. mouse. [Q9D8P4-2 ]

    Organism-specific databases

    CTDi 63875.
    MGIi MGI:1351608. Mrpl17.

    Phylogenomic databases

    eggNOGi COG0203.
    GeneTreei ENSGT00390000010698.
    HOGENOMi HOG000019780.
    HOVERGENi HBG056029.
    InParanoidi Q9D8P4.
    KOi K02879.
    OMAi GDTDEKA.
    OrthoDBi EOG74TX11.
    PhylomeDBi Q9D8P4.
    TreeFami TF105844.

    Miscellaneous databases

    NextBioi 305376.
    PROi Q9D8P4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9D8P4.
    Bgeei Q9D8P4.
    CleanExi MM_MRPL17.
    Genevestigatori Q9D8P4.

    Family and domain databases

    Gene3Di 3.90.1030.10. 1 hit.
    InterProi IPR000456. Ribosomal_L17.
    [Graphical view ]
    PANTHERi PTHR14413. PTHR14413. 1 hit.
    Pfami PF01196. Ribosomal_L17. 1 hit.
    [Graphical view ]
    SUPFAMi SSF64263. SSF64263. 1 hit.
    TIGRFAMsi TIGR00059. L17. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Pancreas.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: FVB/N.
      Tissue: Mammary gland.
    3. Lubec G., Sunyer B., Chen W.-Q.
      Submitted (JAN-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 1-13, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: OF1.
      Tissue: Hippocampus.

    Entry informationi

    Entry nameiRM17_MOUSE
    AccessioniPrimary (citable) accession number: Q9D8P4
    Secondary accession number(s): Q91VR0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 93 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Ribosomal proteins
      Ribosomal proteins families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3