Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9D8P4 (RM17_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 89. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
39S ribosomal protein L17, mitochondrial

Short name=L17mt
Short name=MRP-L17
Gene names
Name:Mrpl17
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length176 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Mitochondrion Potential.

Sequence similarities

Belongs to the ribosomal protein L17P family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9D8P4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9D8P4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     82-116: EKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQ → VSAPYLLVRKESLENRVPGRLKAGHSFMYQTCELP
     117-176: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 88Mitochondrion By similarity
Chain9 – 17616839S ribosomal protein L17, mitochondrial
PRO_0000237332

Natural variations

Alternative sequence82 – 11635EKDLI…NRKEQ → VSAPYLLVRKESLENRVPGR LKAGHSFMYQTCELP in isoform 2.
VSP_018590
Alternative sequence117 – 17660Missing in isoform 2.
VSP_018591

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 3A0CBC71740A4E42

FASTA17620,249
        10         20         30         40         50         60 
MRLSLAAAIS HGRVYRRLGL GPESRIHLLR NLLTGLVRHE RIEATWARAD EMRGYAEKLI 

        70         80         90        100        110        120 
DYGKLGDTNE RAMRMADFWL TEKDLIPKLF KVLAPRFQGQ NGNYTRMLQI PNRKEQDRAK 

       130        140        150        160        170 
MAVIEYKGNY LPPLPLPHRD SNLTLLNQLL LGLQQDLHHN QDASLHSSCT VQTPKT 

« Hide

Isoform 2 [UniParc].

Checksum: 9627DA824FA17466
Show »

FASTA11613,340

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Pancreas.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: FVB/N.
Tissue: Mammary gland.
[3]Lubec G., Sunyer B., Chen W.-Q.
Submitted (JAN-2009) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 1-13, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: OF1.
Tissue: Hippocampus.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK007828 mRNA. Translation: BAB25288.1.
AK144092 mRNA. Translation: BAE25695.1.
AK147957 mRNA. Translation: BAE28251.1.
BC010718 mRNA. Translation: AAH10718.1.
RefSeqNP_079577.1. NM_025301.2.
UniGeneMm.44225.

3D structure databases

ProteinModelPortalQ9D8P4.
SMRQ9D8P4. Positions 28-129.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ9D8P4.

Proteomic databases

PaxDbQ9D8P4.
PRIDEQ9D8P4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879. [Q9D8P4-1]
GeneID27397.
KEGGmmu:27397.
UCSCuc009izl.1. mouse. [Q9D8P4-1]
uc009izm.1. mouse. [Q9D8P4-2]

Organism-specific databases

CTD63875.
MGIMGI:1351608. Mrpl17.

Phylogenomic databases

eggNOGCOG0203.
GeneTreeENSGT00390000010698.
HOGENOMHOG000019780.
HOVERGENHBG056029.
InParanoidQ9D8P4.
KOK02879.
OMAGDTDEKA.
OrthoDBEOG74TX11.
PhylomeDBQ9D8P4.
TreeFamTF105844.

Gene expression databases

ArrayExpressQ9D8P4.
BgeeQ9D8P4.
CleanExMM_MRPL17.
GenevestigatorQ9D8P4.

Family and domain databases

Gene3D3.90.1030.10. 1 hit.
InterProIPR000456. Ribosomal_L17.
[Graphical view]
PANTHERPTHR14413. PTHR14413. 1 hit.
PfamPF01196. Ribosomal_L17. 1 hit.
[Graphical view]
SUPFAMSSF64263. SSF64263. 1 hit.
TIGRFAMsTIGR00059. L17. 1 hit.
ProtoNetSearch...

Other

NextBio305376.
PROQ9D8P4.
SOURCESearch...

Entry information

Entry nameRM17_MOUSE
AccessionPrimary (citable) accession number: Q9D8P4
Secondary accession number(s): Q91VR0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Ribosomal proteins

Ribosomal proteins families and list of entries

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot