Q9D8P4 (RM17_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 39S ribosomal protein L17, mitochondrial Short name=L17mt Short name=MRP-L17 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 176 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Mitochondrion Potential. |
| Sequence similarities | Belongs to the ribosomal protein L17P family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Molecular function | Ribonucleoprotein Ribosomal protein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | mitochondrial genome maintenance Traceable author statement PubMed 10593885. Source: MGI translationInferred from sequence alignment PubMed 10593885. Source: MGI |
| Cellular_component | mitochondrial inner membrane Inferred from direct assay PubMed 12865426. Source: MGI mitochondrial large ribosomal subunitInferred from sequence alignment PubMed 10593885. Source: MGI |
| Molecular_function | structural constituent of ribosome Inferred from sequence alignment PubMed 10593885. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9D8P4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9D8P4-2) The sequence of this isoform differs from the canonical sequence as follows: 82-116: EKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQ → VSAPYLLVRKESLENRVPGRLKAGHSFMYQTCELP 117-176: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 8 | 8 | Mitochondrion By similarity | ||||||
| Chain | 9 – 176 | 168 | 39S ribosomal protein L17, mitochondrial | PRO_0000237332 | |||||
Natural variations | |||||||||
| Alternative sequence | 82 – 116 | 35 | EKDLI…NRKEQ → VSAPYLLVRKESLENRVPGR LKAGHSFMYQTCELP in isoform 2. | VSP_018590 | |||||
| Alternative sequence | 117 – 176 | 60 | Missing in isoform 2. | VSP_018591 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Pancreas. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. Tissue: Mammary gland. |
| [3] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 1-13, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK007828 mRNA. Translation: BAB25288.1. AK144092 mRNA. Translation: BAE25695.1. AK147957 mRNA. Translation: BAE28251.1. BC010718 mRNA. Translation: AAH10718.1. |
| IPI | IPI00111784. IPI00473469. |
| RefSeq | NP_079577.1. NM_025301.2. |
| UniGene | Mm.44225. |
3D structure databases | |
| ProteinModelPortal | Q9D8P4. |
| SMR | Q9D8P4. Positions 28-129. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9D8P4. |
Proteomic databases | |
| PaxDb | Q9D8P4. |
| PRIDE | Q9D8P4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879. |
| GeneID | 27397. |
| KEGG | mmu:27397. |
| UCSC | uc009izl.1. mouse. uc009izm.1. mouse. |
Organism-specific databases | |
| CTD | 63875. |
| MGI | MGI:1351608. Mrpl17. |
Phylogenomic databases | |
| eggNOG | COG0203. |
| GeneTree | ENSGT00390000010698. |
| HOGENOM | HOG000019780. |
| HOVERGEN | HBG056029. |
| InParanoid | Q9D8P4. |
| KO | K02879. |
| OMA | DEVRFYA. |
| OrthoDB | EOG41C6XH. |
Gene expression databases | |
| ArrayExpress | Q9D8P4. |
| Bgee | Q9D8P4. |
| CleanEx | MM_MRPL17. |
| Genevestigator | Q9D8P4. |
| GermOnline | ENSMUSG00000030879. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.90.1030.10. 1 hit. |
| InterPro | IPR000456. Ribosomal_L17. [Graphical view] |
| PANTHER | PTHR14413. PTHR14413. 1 hit. |
| Pfam | PF01196. Ribosomal_L17. 1 hit. [Graphical view] |
| SUPFAM | SSF64263. Ribosomal_L17. 1 hit. |
| TIGRFAMs | TIGR00059. L17. 1 hit. |
| PROSITE | PS01167. RIBOSOMAL_L17. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 305376. |
| SOURCE | Search... |
Entry information
| Entry name | RM17_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9D8P4 Secondary accession number(s): Q91VR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Ribosomal proteins Ribosomal proteins families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
