Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L17, mitochondrial

Gene

Mrpl17

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. protein domain specific binding Source: MGI
  2. structural constituent of ribosome Source: MGI

GO - Biological processi

  1. mitochondrial genome maintenance Source: MGI
  2. translation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiREACT_292710. Mitochondrial translation elongation.
REACT_344470. Mitochondrial translation termination.
REACT_350780. Mitochondrial translation initiation.

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L17, mitochondrial
Short name:
L17mt
Short name:
MRP-L17
Gene namesi
Name:Mrpl17
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1351608. Mrpl17.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrial inner membrane Source: MGI
  2. mitochondrial large ribosomal subunit Source: MGI
  3. mitochondrion Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 88MitochondrionBy similarity
Chaini9 – 17616839S ribosomal protein L17, mitochondrialPRO_0000237332Add
BLAST

Proteomic databases

MaxQBiQ9D8P4.
PaxDbiQ9D8P4.
PRIDEiQ9D8P4.

PTM databases

PhosphoSiteiQ9D8P4.

Expressioni

Gene expression databases

BgeeiQ9D8P4.
CleanExiMM_MRPL17.
ExpressionAtlasiQ9D8P4. baseline and differential.
GenevestigatoriQ9D8P4.

Structurei

3D structure databases

ProteinModelPortaliQ9D8P4.
SMRiQ9D8P4. Positions 9-128.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ribosomal protein L17P family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0203.
GeneTreeiENSGT00390000010698.
HOGENOMiHOG000019780.
HOVERGENiHBG056029.
InParanoidiQ9D8P4.
KOiK02879.
OMAiGDTDEKA.
OrthoDBiEOG74TX11.
PhylomeDBiQ9D8P4.
TreeFamiTF105844.

Family and domain databases

Gene3Di3.90.1030.10. 1 hit.
InterProiIPR000456. Ribosomal_L17.
[Graphical view]
PANTHERiPTHR14413. PTHR14413. 1 hit.
PfamiPF01196. Ribosomal_L17. 1 hit.
[Graphical view]
SUPFAMiSSF64263. SSF64263. 1 hit.
TIGRFAMsiTIGR00059. L17. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D8P4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRLSLAAAIS HGRVYRRLGL GPESRIHLLR NLLTGLVRHE RIEATWARAD
60 70 80 90 100
EMRGYAEKLI DYGKLGDTNE RAMRMADFWL TEKDLIPKLF KVLAPRFQGQ
110 120 130 140 150
NGNYTRMLQI PNRKEQDRAK MAVIEYKGNY LPPLPLPHRD SNLTLLNQLL
160 170
LGLQQDLHHN QDASLHSSCT VQTPKT
Length:176
Mass (Da):20,249
Last modified:June 1, 2001 - v1
Checksum:i3A0CBC71740A4E42
GO
Isoform 2 (identifier: Q9D8P4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     82-116: EKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQ → VSAPYLLVRKESLENRVPGRLKAGHSFMYQTCELP
     117-176: Missing.

Show »
Length:116
Mass (Da):13,340
Checksum:i9627DA824FA17466
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei82 – 11635EKDLI…NRKEQ → VSAPYLLVRKESLENRVPGR LKAGHSFMYQTCELP in isoform 2. 1 PublicationVSP_018590Add
BLAST
Alternative sequencei117 – 17660Missing in isoform 2. 1 PublicationVSP_018591Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007828 mRNA. Translation: BAB25288.1.
AK144092 mRNA. Translation: BAE25695.1.
AK147957 mRNA. Translation: BAE28251.1.
BC010718 mRNA. Translation: AAH10718.1.
CCDSiCCDS21662.1. [Q9D8P4-1]
RefSeqiNP_079577.1. NM_025301.2. [Q9D8P4-1]
UniGeneiMm.44225.

Genome annotation databases

EnsembliENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879. [Q9D8P4-1]
GeneIDi27397.
KEGGimmu:27397.
UCSCiuc009izl.1. mouse. [Q9D8P4-1]
uc009izm.1. mouse. [Q9D8P4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007828 mRNA. Translation: BAB25288.1.
AK144092 mRNA. Translation: BAE25695.1.
AK147957 mRNA. Translation: BAE28251.1.
BC010718 mRNA. Translation: AAH10718.1.
CCDSiCCDS21662.1. [Q9D8P4-1]
RefSeqiNP_079577.1. NM_025301.2. [Q9D8P4-1]
UniGeneiMm.44225.

3D structure databases

ProteinModelPortaliQ9D8P4.
SMRiQ9D8P4. Positions 9-128.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

PhosphoSiteiQ9D8P4.

Proteomic databases

MaxQBiQ9D8P4.
PaxDbiQ9D8P4.
PRIDEiQ9D8P4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879. [Q9D8P4-1]
GeneIDi27397.
KEGGimmu:27397.
UCSCiuc009izl.1. mouse. [Q9D8P4-1]
uc009izm.1. mouse. [Q9D8P4-2]

Organism-specific databases

CTDi63875.
MGIiMGI:1351608. Mrpl17.

Phylogenomic databases

eggNOGiCOG0203.
GeneTreeiENSGT00390000010698.
HOGENOMiHOG000019780.
HOVERGENiHBG056029.
InParanoidiQ9D8P4.
KOiK02879.
OMAiGDTDEKA.
OrthoDBiEOG74TX11.
PhylomeDBiQ9D8P4.
TreeFamiTF105844.

Enzyme and pathway databases

ReactomeiREACT_292710. Mitochondrial translation elongation.
REACT_344470. Mitochondrial translation termination.
REACT_350780. Mitochondrial translation initiation.

Miscellaneous databases

NextBioi305376.
PROiQ9D8P4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9D8P4.
CleanExiMM_MRPL17.
ExpressionAtlasiQ9D8P4. baseline and differential.
GenevestigatoriQ9D8P4.

Family and domain databases

Gene3Di3.90.1030.10. 1 hit.
InterProiIPR000456. Ribosomal_L17.
[Graphical view]
PANTHERiPTHR14413. PTHR14413. 1 hit.
PfamiPF01196. Ribosomal_L17. 1 hit.
[Graphical view]
SUPFAMiSSF64263. SSF64263. 1 hit.
TIGRFAMsiTIGR00059. L17. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Pancreas.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary gland.
  3. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 1-13, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.

Entry informationi

Entry nameiRM17_MOUSE
AccessioniPrimary (citable) accession number: Q9D8P4
Secondary accession number(s): Q91VR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: June 1, 2001
Last modified: April 1, 2015
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Ribosomal proteins
    Ribosomal proteins families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.