Q9D868 (PPIH_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Peptidyl-prolyl cis-trans isomerase H Short name=PPIase H EC=5.2.1.8 Alternative name(s): Rotamase H | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 188 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone By similarity. |
| Catalytic activity | Peptidylproline (omega=180) = peptidylproline (omega=0). |
| Enzyme regulation | Inhibited by cyclosporin A By similarity. |
| Subunit structure | Interacts directly with PRPF4. Part of a heteromeric complex containing PPIH, PRPF3 and PRPF4 that is stable in the absence of RNA. Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Heterodimer with PRPF18. Heterodimer with PRPF18 By similarity. |
| Subcellular location | Nucleus speckle By similarity. Cytoplasm By similarity. Note: Colocalizes with spliceosomal snRNPs. A small proportion may also be cytoplasmic By similarity. |
| Sequence similarities | Belongs to the cyclophilin-type PPIase family. PPIase H subfamily. Contains 1 PPIase cyclophilin-type domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9D868-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9D868-2) The sequence of this isoform differs from the canonical sequence as follows: 156-188: FQAPLGKRVQAWTHSLTCPALTGILALILMPTE → NVPTGPNNKPKLPVVISQCGEM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 188 | 188 | Peptidyl-prolyl cis-trans isomerase H | PRO_0000064163 | |||||
Regions | |||||||||
| Domain | 14 – 176 | 163 | PPIase cyclophilin-type | ||||||
Natural variations | |||||||||
| Alternative sequence | 156 – 188 | 33 | FQAPL…LMPTE → NVPTGPNNKPKLPVVISQCG EM in isoform 2. | VSP_008325 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Cerebellum, Embryo, Head and Small intestine. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Mammary cancer and Pancreas. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK003179 mRNA. Translation: BAB22623.1. AK008394 mRNA. Translation: BAB25645.1. AK005202 mRNA. Translation: BAB23880.1. AK014665 mRNA. Translation: BAB29493.1. BC016565 mRNA. No translation available. BC050116 mRNA. Translation: AAH50116.1. |
| IPI | IPI00112065. IPI00133136. |
| RefSeq | NP_001103599.1. NM_001110129.1. NP_001103600.1. NM_001110130.1. NP_082953.1. NM_028677.4. |
| UniGene | Mm.304080. Mm.371613. Mm.380651. |
3D structure databases | |
| ProteinModelPortal | Q9D868. |
| SMR | Q9D868. Positions 5-155. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9D868. |
Proteomic databases | |
| PaxDb | Q9D868. |
| PRIDE | Q9D868. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000056458; ENSMUSP00000051221; ENSMUSG00000060288. ENSMUST00000106317; ENSMUSP00000101924; ENSMUSG00000060288. ENSMUST00000106318; ENSMUSP00000101925; ENSMUSG00000060288. ENSMUST00000106321; ENSMUSP00000101928; ENSMUSG00000060288. |
| GeneID | 66101. |
| KEGG | mmu:66101. |
Organism-specific databases | |
| CTD | 10465. |
| MGI | MGI:106499. Ppih. |
Phylogenomic databases | |
| eggNOG | COG0652. |
| GeneTree | ENSGT00550000074595. |
| HOGENOM | HOG000065981. |
| HOVERGEN | HBG001065. |
| InParanoid | Q9D868. |
| KO | K09567. |
| OMA | GYKGASF. |
| OrthoDB | EOG4ZS946. |
Gene expression databases | |
| ArrayExpress | Q9D868. |
| Bgee | Q9D868. |
| CleanEx | MM_PPIH. |
| Genevestigator | Q9D868. |
| GermOnline | ENSMUSG00000061206. Mus musculus. |
Family and domain databases | |
| InterPro | IPR002130. Cyclophilin-like_PPIase_dom. IPR024936. Cyclophilin-type_PPIase. IPR020892. Cyclophilin-type_PPIase_CS. [Graphical view] |
| Pfam | PF00160. Pro_isomerase. 1 hit. [Graphical view] |
| PIRSF | PIRSF001467. Peptidylpro_ismrse. 1 hit. |
| PRINTS | PR00153. CSAPPISMRASE. |
| SUPFAM | SSF50891. CSA_PPIase. 1 hit. |
| PROSITE | PS00170. CSA_PPIASE_1. 1 hit. PS50072. CSA_PPIASE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 320626. |
| SOURCE | Search... |
Entry information
| Entry name | PPIH_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9D868 Secondary accession number(s): Q9CQU7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
