Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase H

Gene

Ppih

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone (By similarity).By similarity

Catalytic activityi

Peptidylproline (omega=180) = peptidylproline (omega=0).

Enzyme regulationi

Inhibited by cyclosporin A.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChaperone, Isomerase, Rotamase
Biological processmRNA processing, mRNA splicing

Enzyme and pathway databases

ReactomeiR-MMU-72163. mRNA Splicing - Major Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase H (EC:5.2.1.8)
Short name:
PPIase H
Alternative name(s):
Rotamase H
Gene namesi
Name:Ppih
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componentsi: Chromosome 4, Chromosome 5

Organism-specific databases

MGIiMGI:106499. Ppih.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus, Spliceosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000641632 – 188Peptidyl-prolyl cis-trans isomerase HAdd BLAST187

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ9D868.
PeptideAtlasiQ9D868.
PRIDEiQ9D868.

PTM databases

iPTMnetiQ9D868.
PhosphoSitePlusiQ9D868.

Expressioni

Gene expression databases

BgeeiENSMUSG00000033036.
CleanExiMM_PPIH.
ExpressionAtlasiQ9D868. baseline and differential.
GenevisibleiQ9D868. MM.

Interactioni

Subunit structurei

Interacts directly with PRPF4. Part of a heteromeric complex containing PPIH, PRPF3 and PRPF4 that is stable in the absence of RNA. Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, SNRNP40, DDX23, CD2BP2, PPIH, SNU13, EFTUD2, SART1 and USP39. Heterodimer with PRPF18. Heterodimer with PRPF18 (By similarity).By similarity

Protein-protein interaction databases

IntActiQ9D868. 2 interactors.
MINTiMINT-4108453.
STRINGi10090.ENSMUSP00000101924.

Structurei

3D structure databases

ProteinModelPortaliQ9D868.
SMRiQ9D868.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini14 – 176PPIase cyclophilin-typePROSITE-ProRule annotationAdd BLAST163

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0546. Eukaryota.
COG0652. LUCA.
GeneTreeiENSGT00760000119072.
HOGENOMiHOG000065981.
HOVERGENiHBG001065.
InParanoidiQ9D868.
KOiK09567.
OMAiGNPLVFF.
OrthoDBiEOG091G0BGL.
PhylomeDBiQ9D868.
TreeFamiTF312958.

Family and domain databases

Gene3Di2.40.100.10. 1 hit.
InterProiView protein in InterPro
IPR029000. Cyclophilin-like_dom.
IPR024936. Cyclophilin-type_PPIase.
IPR020892. Cyclophilin-type_PPIase_CS.
IPR002130. Cyclophilin-type_PPIase_dom.
PANTHERiPTHR11071. PTHR11071. 1 hit.
PfamiView protein in Pfam
PF00160. Pro_isomerase. 1 hit.
PRINTSiPR00153. CSAPPISMRASE.
SUPFAMiSSF50891. SSF50891. 1 hit.
PROSITEiView protein in PROSITE
PS00170. CSA_PPIASE_1. 1 hit.
PS50072. CSA_PPIASE_2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D868-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVANSSPVN PVVFFDVSIG GQEVGRMKIE LFADVVPKTA ENFRQFCTGE
60 70 80 90 100
FRKDGVPIGY KGSTFHRVIK DFMIQGGDFV NGDGTGVASI YRGPFADENF
110 120 130 140 150
KLRHSAPGLL SMANSGPSTN GCQFFITCSK CDWLDGKHVV FGKIIDGLLV
160 170 180
MRKIEFQAPL GKRVQAWTHS LTCPALTGIL ALILMPTE
Length:188
Mass (Da):20,464
Last modified:June 1, 2001 - v1
Checksum:iE11D29067BA98101
GO
Isoform 2 (identifier: Q9D868-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-188: FQAPLGKRVQAWTHSLTCPALTGILALILMPTE → NVPTGPNNKPKLPVVISQCGEM

Show »
Length:177
Mass (Da):19,208
Checksum:i566BCE6361E0F339
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_008325156 – 188FQAPL…LMPTE → NVPTGPNNKPKLPVVISQCG EM in isoform 2. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK003179 mRNA. Translation: BAB22623.1.
AK008394 mRNA. Translation: BAB25645.1.
AK005202 mRNA. Translation: BAB23880.1.
AK014665 mRNA. Translation: BAB29493.1.
BC016565 mRNA. No translation available.
BC050116 mRNA. Translation: AAH50116.1.
CCDSiCCDS18580.1. [Q9D868-2]
CCDS51288.1. [Q9D868-1]
RefSeqiNP_001103599.1. NM_001110129.1. [Q9D868-2]
NP_001103600.1. NM_001110130.1. [Q9D868-1]
NP_082953.1. NM_028677.4. [Q9D868-2]
UniGeneiMm.304080.
Mm.371613.
Mm.380651.

Genome annotation databases

EnsembliENSMUST00000056458; ENSMUSP00000051221; ENSMUSG00000060288. [Q9D868-2]
ENSMUST00000106317; ENSMUSP00000101924; ENSMUSG00000060288. [Q9D868-1]
ENSMUST00000106318; ENSMUSP00000101925; ENSMUSG00000060288. [Q9D868-2]
ENSMUST00000106321; ENSMUSP00000101928; ENSMUSG00000060288. [Q9D868-2]
ENSMUST00000122204; ENSMUSP00000142767; ENSMUSG00000033036. [Q9D868-2]
GeneIDi66101.
KEGGimmu:66101.
UCSCiuc008ulz.2. mouse. [Q9D868-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPIH_MOUSE
AccessioniPrimary (citable) accession number: Q9D868
Secondary accession number(s): Q9CQU7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: June 1, 2001
Last modified: August 30, 2017
This is version 133 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families