Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

Msra

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).By similarity

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

GO - Molecular functioni

  • peptide-methionine (S)-S-oxide reductase activity Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Enzyme and pathway databases

BRENDAi1.8.4.11. 3474.
ReactomeiR-MMU-5676934. Protein repair.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
Gene namesi
Name:Msra
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:106916. Msra.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • cytoplasm Source: MGI
  • extracellular exosome Source: MGI
  • membrane Source: UniProtKB-SubCell
  • mitochondrion Source: MGI
  • nucleoplasm Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 20MitochondrionBy similarityAdd BLAST20
ChainiPRO_000013862721 – 233Mitochondrial peptide methionine sulfoxide reductaseAdd BLAST213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei104N6-acetyllysine; alternateCombined sources1
Modified residuei104N6-succinyllysine; alternateCombined sources1
Modified residuei183N6-acetyllysine; alternateCombined sources1
Modified residuei183N6-succinyllysine; alternateCombined sources1
Isoform 2 (identifier: Q9D6Y7-2)
Lipidationi2N-myristoyl glycine1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate

Proteomic databases

PaxDbiQ9D6Y7.
PeptideAtlasiQ9D6Y7.
PRIDEiQ9D6Y7.

PTM databases

iPTMnetiQ9D6Y7.
PhosphoSitePlusiQ9D6Y7.
SwissPalmiQ9D6Y7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000054733.
CleanExiMM_MSRA.
GenevisibleiQ9D6Y7. MM.

Interactioni

Protein-protein interaction databases

IntActiQ9D6Y7. 4 interactors.
MINTiMINT-1854772.
STRINGi10090.ENSMUSP00000065754.

Structurei

Secondary structure

1233
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi24 – 26Combined sources3
Turni31 – 33Combined sources3
Turni49 – 51Combined sources3
Beta strandi55 – 58Combined sources4
Beta strandi64 – 69Combined sources6
Helixi73 – 81Combined sources9
Beta strandi83 – 95Combined sources13
Helixi103 – 106Combined sources4
Beta strandi114 – 121Combined sources8
Turni123 – 125Combined sources3
Helixi128 – 137Combined sources10
Beta strandi144 – 147Combined sources4
Beta strandi150 – 152Combined sources3
Beta strandi158 – 160Combined sources3
Helixi164 – 182Combined sources19
Turni183 – 185Combined sources3
Helixi204 – 206Combined sources3
Helixi209 – 212Combined sources4
Turni228 – 230Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L90NMR-A22-233[»]
ProteinModelPortaliQ9D6Y7.
SMRiQ9D6Y7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1635. Eukaryota.
COG0225. LUCA.
GeneTreeiENSGT00390000003823.
HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ9D6Y7.
KOiK07304.
OMAiMVLRSEI.
OrthoDBiEOG091G0MD8.
PhylomeDBiQ9D6Y7.
TreeFamiTF353884.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA. 1 hit.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket

Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon. According to PubMed:15924425, differential subcellular targeting is not due alternative initiation.1 Publication
Isoform 1 (identifier: Q9D6Y7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSASRRALQ LLSSANPVRR MGDSASKVIS AEEALPGRTE PIPVTAKHHV
60 70 80 90 100
SGNRTVEPFP EGTQMAVFGM GCFWGAERKF WVLKGVYSTQ VGFAGGHTRN
110 120 130 140 150
PTYKEVCSEK TGHAEVVRVV YRPEHISFEE LLKVFWENHD PTQGMRQGND
160 170 180 190 200
FGTQYRSAVY PTSAVQMEAA LRSKEEYQKV LSKHNFGPIT TDIREGQVFY
210 220 230
YAEDYHQQYL SKNPDGYCGL GGTGVSCPMA IKK
Note: Mitochondrial.
Length:233
Mass (Da):25,988
Last modified:June 1, 2001 - v1
Checksum:iB16EFE01BE751242
GO
Isoform 2 (identifier: Q9D6Y7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: Missing.

Note: Cytoplasmic. Produced by alternative initiation.
Show »
Length:213
Mass (Da):23,780
Checksum:i016CA48DFF31A154
GO
Isoform 3 (identifier: Q9D6Y7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-108: Missing.

Show »
Length:193
Mass (Da):21,550
Checksum:iBF6451CEEF2B8C7E
GO
Isoform 4 (identifier: Q9D6Y7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVT → MSK

Show »
Length:191
Mass (Da):21,588
Checksum:i05A91F2966016833
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti20R → G in BAB22035 (PubMed:16141072).Curated1
Sequence conflicti156R → P in AK018338 (PubMed:16141072).Curated1
Sequence conflicti187G → V in BAB22035 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414081 – 45MLSAS…PIPVT → MSK in isoform 4. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0421331 – 20Missing in isoform 2. CuratedAdd BLAST20
Alternative sequenceiVSP_04140969 – 108Missing in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002356 mRNA. Translation: BAB22035.1.
AK009822 mRNA. Translation: BAB26522.1.
AK049714 mRNA. Translation: BAC33889.1.
AK018338 mRNA. No translation available.
CH466535 Genomic DNA. Translation: EDL36048.1.
BC014738 mRNA. Translation: AAH14738.1.
BC089311 mRNA. Translation: AAH89311.1.
CCDSiCCDS27209.1. [Q9D6Y7-1]
RefSeqiNP_001240641.1. NM_001253712.1. [Q9D6Y7-1]
NP_001240643.1. NM_001253714.1.
NP_001240644.1. NM_001253715.1. [Q9D6Y7-3]
NP_001240645.1. NM_001253716.1. [Q9D6Y7-4]
NP_080598.2. NM_026322.4. [Q9D6Y7-1]
UniGeneiMm.26713.

Genome annotation databases

EnsembliENSMUST00000067927; ENSMUSP00000065754; ENSMUSG00000054733. [Q9D6Y7-1]
ENSMUST00000210428; ENSMUSP00000147689; ENSMUSG00000054733. [Q9D6Y7-4]
GeneIDi110265.
KEGGimmu:110265.
UCSCiuc007uig.2. mouse. [Q9D6Y7-4]
uc007uih.2. mouse. [Q9D6Y7-3]
uc007uii.2. mouse. [Q9D6Y7-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002356 mRNA. Translation: BAB22035.1.
AK009822 mRNA. Translation: BAB26522.1.
AK049714 mRNA. Translation: BAC33889.1.
AK018338 mRNA. No translation available.
CH466535 Genomic DNA. Translation: EDL36048.1.
BC014738 mRNA. Translation: AAH14738.1.
BC089311 mRNA. Translation: AAH89311.1.
CCDSiCCDS27209.1. [Q9D6Y7-1]
RefSeqiNP_001240641.1. NM_001253712.1. [Q9D6Y7-1]
NP_001240643.1. NM_001253714.1.
NP_001240644.1. NM_001253715.1. [Q9D6Y7-3]
NP_001240645.1. NM_001253716.1. [Q9D6Y7-4]
NP_080598.2. NM_026322.4. [Q9D6Y7-1]
UniGeneiMm.26713.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L90NMR-A22-233[»]
ProteinModelPortaliQ9D6Y7.
SMRiQ9D6Y7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9D6Y7. 4 interactors.
MINTiMINT-1854772.
STRINGi10090.ENSMUSP00000065754.

PTM databases

iPTMnetiQ9D6Y7.
PhosphoSitePlusiQ9D6Y7.
SwissPalmiQ9D6Y7.

Proteomic databases

PaxDbiQ9D6Y7.
PeptideAtlasiQ9D6Y7.
PRIDEiQ9D6Y7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000067927; ENSMUSP00000065754; ENSMUSG00000054733. [Q9D6Y7-1]
ENSMUST00000210428; ENSMUSP00000147689; ENSMUSG00000054733. [Q9D6Y7-4]
GeneIDi110265.
KEGGimmu:110265.
UCSCiuc007uig.2. mouse. [Q9D6Y7-4]
uc007uih.2. mouse. [Q9D6Y7-3]
uc007uii.2. mouse. [Q9D6Y7-1]

Organism-specific databases

CTDi4482.
MGIiMGI:106916. Msra.

Phylogenomic databases

eggNOGiKOG1635. Eukaryota.
COG0225. LUCA.
GeneTreeiENSGT00390000003823.
HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ9D6Y7.
KOiK07304.
OMAiMVLRSEI.
OrthoDBiEOG091G0MD8.
PhylomeDBiQ9D6Y7.
TreeFamiTF353884.

Enzyme and pathway databases

BRENDAi1.8.4.11. 3474.
ReactomeiR-MMU-5676934. Protein repair.

Miscellaneous databases

ChiTaRSiMsra. mouse.
PROiQ9D6Y7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000054733.
CleanExiMM_MSRA.
GenevisibleiQ9D6Y7. MM.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA. 1 hit.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMSRA_MOUSE
AccessioniPrimary (citable) accession number: Q9D6Y7
Secondary accession number(s): Q5EBQ7, Q91WK9, Q9DCY2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2004
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.