Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CKLF-like MARVEL transmembrane domain-containing protein 5

Gene

Cmtm5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

  • chemotaxis Source: UniProtKB-KW
  • negative regulation of myoblast differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Keywords - Biological processi

Chemotaxis

Names & Taxonomyi

Protein namesi
Recommended name:
CKLF-like MARVEL transmembrane domain-containing protein 5
Alternative name(s):
Chemokine-like factor superfamily member 5
Gene namesi
Name:Cmtm5
Synonyms:Cklfsf5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:2447164. Cmtm5.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei35 – 55HelicalSequence analysisAdd BLAST21
Transmembranei56 – 76HelicalSequence analysisAdd BLAST21
Transmembranei93 – 113HelicalSequence analysisAdd BLAST21
Transmembranei119 – 139HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001861061 – 156CKLF-like MARVEL transmembrane domain-containing protein 5Add BLAST156

Proteomic databases

PaxDbiQ9D6G9.
PRIDEiQ9D6G9.

PTM databases

iPTMnetiQ9D6G9.
PhosphoSitePlusiQ9D6G9.

Expressioni

Gene expression databases

BgeeiENSMUSG00000040759.
GenevisibleiQ9D6G9. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000036138.

Structurei

3D structure databases

ProteinModelPortaliQ9D6G9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini29 – 146MARVELPROSITE-ProRule annotationAdd BLAST118

Sequence similaritiesi

Belongs to the chemokine-like factor family.Curated
Contains 1 MARVEL domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4788. Eukaryota.
ENOG4111IAF. LUCA.
GeneTreeiENSGT00530000063326.
HOGENOMiHOG000290654.
HOVERGENiHBG053619.
InParanoidiQ9D6G9.
OMAiYRTEMAP.
OrthoDBiEOG091G0VCU.
PhylomeDBiQ9D6G9.
TreeFamiTF317387.

Family and domain databases

InterProiIPR008253. Marvel.
[Graphical view]
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D6G9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSAWDRRER PPEEGAAAGL QGFGVDKTFL SSLKGILLET ELALTFIIFI
60 70 80 90 100
CFTASISAYM AAALLEFLIT LAFLFLCATQ YYQRFDRLNW PCLDFLRCLS
110 120 130 140 150
AIVIFLVVSF AAVTSREGAA IAAFVFGIIL VSVFAYDAFK IYRTELMPST

TEGDQQ
Length:156
Mass (Da):17,389
Last modified:June 1, 2001 - v1
Checksum:i450F36EA49D737BE
GO
Isoform 2 (identifier: Q9D6G9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-93: LTFIIFICFTASISAYMAAALLEFLITLAFLFLCATQYYQRFDRLNWPCL → PQ

Note: No experimental confirmation available.
Show »
Length:108
Mass (Da):11,784
Checksum:iC92A435F85EF933A
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00826644 – 93LTFII…NWPCL → PQ in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY241867 mRNA. Translation: AAP33489.1.
AK005168 mRNA. Translation: BAB23858.1.
AK013666 mRNA. Translation: BAB28947.1.
BC049665 mRNA. Translation: AAH49665.1.
CCDSiCCDS27105.1. [Q9D6G9-1]
RefSeqiNP_080342.1. NM_026066.2. [Q9D6G9-1]
XP_017171651.1. XM_017316162.1. [Q9D6G9-1]
UniGeneiMm.41614.

Genome annotation databases

EnsembliENSMUST00000037814; ENSMUSP00000036138; ENSMUSG00000040759. [Q9D6G9-1]
GeneIDi67272.
KEGGimmu:67272.
UCSCiuc007txo.1. mouse. [Q9D6G9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY241867 mRNA. Translation: AAP33489.1.
AK005168 mRNA. Translation: BAB23858.1.
AK013666 mRNA. Translation: BAB28947.1.
BC049665 mRNA. Translation: AAH49665.1.
CCDSiCCDS27105.1. [Q9D6G9-1]
RefSeqiNP_080342.1. NM_026066.2. [Q9D6G9-1]
XP_017171651.1. XM_017316162.1. [Q9D6G9-1]
UniGeneiMm.41614.

3D structure databases

ProteinModelPortaliQ9D6G9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000036138.

PTM databases

iPTMnetiQ9D6G9.
PhosphoSitePlusiQ9D6G9.

Proteomic databases

PaxDbiQ9D6G9.
PRIDEiQ9D6G9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000037814; ENSMUSP00000036138; ENSMUSG00000040759. [Q9D6G9-1]
GeneIDi67272.
KEGGimmu:67272.
UCSCiuc007txo.1. mouse. [Q9D6G9-1]

Organism-specific databases

CTDi116173.
MGIiMGI:2447164. Cmtm5.

Phylogenomic databases

eggNOGiKOG4788. Eukaryota.
ENOG4111IAF. LUCA.
GeneTreeiENSGT00530000063326.
HOGENOMiHOG000290654.
HOVERGENiHBG053619.
InParanoidiQ9D6G9.
OMAiYRTEMAP.
OrthoDBiEOG091G0VCU.
PhylomeDBiQ9D6G9.
TreeFamiTF317387.

Miscellaneous databases

PROiQ9D6G9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040759.
GenevisibleiQ9D6G9. MM.

Family and domain databases

InterProiIPR008253. Marvel.
[Graphical view]
PROSITEiPS51225. MARVEL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCKLF5_MOUSE
AccessioniPrimary (citable) accession number: Q9D6G9
Secondary accession number(s): Q9DB66
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.