Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Katanin p60 ATPase-containing subunit A-like 2

Gene

Katnal2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.UniRule annotation

Catalytic activityi

ATP + H2O = ADP + phosphate.UniRule annotation

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi295 – 302ATPUniRule annotation8

GO - Molecular functioni

Keywordsi

Molecular functionHydrolase
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Katanin p60 ATPase-containing subunit A-like 2UniRule annotation (EC:3.6.4.3UniRule annotation)
Short name:
Katanin p60 subunit A-like 2UniRule annotation
Alternative name(s):
p60 katanin-like 2UniRule annotation
Gene namesi
Name:Katnal2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:1924234. Katnal2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003337931 – 539Katanin p60 ATPase-containing subunit A-like 2Add BLAST539

Proteomic databases

PaxDbiQ9D3R6.
PRIDEiQ9D3R6.

PTM databases

iPTMnetiQ9D3R6.
PhosphoSitePlusiQ9D3R6.

Expressioni

Gene expression databases

BgeeiENSMUSG00000025420.
ExpressionAtlasiQ9D3R6. baseline and differential.
GenevisibleiQ9D3R6. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000026486.

Structurei

3D structure databases

ProteinModelPortaliQ9D3R6.
SMRiQ9D3R6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 57LisHUniRule annotationAdd BLAST33

Sequence similaritiesi

Belongs to the AAA ATPase family. Katanin p60 subunit A1 subfamily. A-like 2 sub-subfamily.UniRule annotation

Phylogenomic databases

eggNOGiKOG0738. Eukaryota.
ENOG410XPN7. LUCA.
GeneTreeiENSGT00550000074466.
HOGENOMiHOG000225146.
HOVERGENiHBG108053.
InParanoidiQ9D3R6.
KOiK07767.
OMAiKINQQRP.
OrthoDBiEOG091G0Q8J.
PhylomeDBiQ9D3R6.
TreeFamiTF329610.

Family and domain databases

HAMAPiMF_03025. Katanin_p60_AL2. 1 hit.
InterProiView protein in InterPro
IPR003593. AAA+_ATPase.
IPR003959. ATPase_AAA_core.
IPR027497. Katanin_p60_AL2.
IPR006594. LisH.
IPR027417. P-loop_NTPase.
PfamiView protein in Pfam
PF00004. AAA. 1 hit.
PF08513. LisH. 1 hit.
SMARTiView protein in SMART
SM00382. AAA. 1 hit.
SM00667. LisH. 1 hit.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiView protein in PROSITE
PS50896. LISH. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D3R6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELSYQTLKL THQAREAYEM RTEARRKNLL ILILHYLTQE GYMDAAKALE
60 70 80 90 100
EETKLGLRRF EVCDNVDLET ILMEYESYYF VKFQKYPKVV KKAPDPVENN
110 120 130 140 150
LPSRSGGKNK RLTNDSCQNL PKICHQKSRP KTSAVKTGDT KSVKEHLKQV
160 170 180 190 200
KESVTDTQAE STDFGLNISK IHKDQPEEKA QPRRGQIIDF RGLLSDAIKG
210 220 230 240 250
ATSEFALNTF ECNPDPSERL LKPLSAFIGM NSEMRELAAV VSRDIYLHNP
260 270 280 290 300
NIKWNDIIGL DAAKQLVKEA VVYPIRYPQL FTGILSPWKG LLLYGPPGTG
310 320 330 340 350
KTLLAKAVAT ECKTTFFNIS ASTIVSKWRG DSEKLVRVLF ELARYHAPST
360 370 380 390 400
IFLDELESVM SQRGMVPGGE HEGSLRMKTE LLVQMDGLAR SEDLVFVLAA
410 420 430 440 450
SNLPWELDCA MLRRLEKRIL VDLPSQEARQ AMIYHWLPPV SKNHALELHT
460 470 480 490 500
QLEYSVLSQE TEGYSGSDIK LVCREAAMRP VRKIFSVLEN NQSESNNLPG
510 520 530
IQLDTVTTQD FLDVLAHTKP SAKNLTERYL AWQEKFESV
Length:539
Mass (Da):61,153
Last modified:May 20, 2008 - v2
Checksum:i199E141AEF2F402C
GO
Isoform 2 (identifier: Q9D3R6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-151: Missing.
     185-219: GQIIDFRGLLSDAIKGATSEFALNTFECNPDPSER → VSGAQGPRMERGTCLKKKENKAYSCCQTGKRRQKH
     220-539: Missing.

Show »
Length:217
Mass (Da):25,054
Checksum:i64C8E9B44E93C16D
GO
Isoform 3 (identifier: Q9D3R6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-409: LDC → GDA
     410-539: Missing.

Note: No experimental confirmation available.
Show »
Length:409
Mass (Da):46,131
Checksum:i9600B20008DC9749
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033524150 – 151Missing in isoform 2. 1 Publication2
Alternative sequenceiVSP_033525185 – 219GQIID…DPSER → VSGAQGPRMERGTCLKKKEN KAYSCCQTGKRRQKH in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_033526220 – 539Missing in isoform 2. 1 PublicationAdd BLAST320
Alternative sequenceiVSP_033527407 – 409LDC → GDA in isoform 3. 1 Publication3
Alternative sequenceiVSP_033528410 – 539Missing in isoform 3. 1 PublicationAdd BLAST130

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK017114 mRNA. Translation: BAB30604.1.
AC132608 Genomic DNA. No translation available.
BC069977 mRNA. Translation: AAH69977.1.
CCDSiCCDS37865.1. [Q9D3R6-3]
RefSeqiNP_081997.1. NM_027721.2. [Q9D3R6-3]
XP_006526500.1. XM_006526437.3. [Q9D3R6-1]
UniGeneiMm.35803.

Genome annotation databases

EnsembliENSMUST00000026486; ENSMUSP00000026486; ENSMUSG00000025420. [Q9D3R6-3]
ENSMUST00000126153; ENSMUSP00000122079; ENSMUSG00000025420. [Q9D3R6-1]
ENSMUST00000154665; ENSMUSP00000119066; ENSMUSG00000025420. [Q9D3R6-2]
GeneIDi71206.
KEGGimmu:71206.
UCSCiuc008fqx.1. mouse. [Q9D3R6-3]
uc008fqz.1. mouse. [Q9D3R6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKATL2_MOUSE
AccessioniPrimary (citable) accession number: Q9D3R6
Secondary accession number(s): Q6NSQ2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: October 25, 2017
This is version 129 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families