Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

Acp1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.By similarity
A phosphate monoester + H2O = an alcohol + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei13NucleophileBy similarity1
Active sitei19By similarity1
Active sitei130Proton donorBy similarity1

GO - Molecular functioni

  • acid phosphatase activity Source: MGI
  • non-membrane spanning protein tyrosine phosphatase activity Source: InterPro
  • phosphatase activity Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Gene namesi
Name:Acp1
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:87881. Acp1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3593153.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000465592 – 158Low molecular weight phosphotyrosine protein phosphataseAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei132PhosphotyrosineBy similarity1
Modified residuei133PhosphotyrosineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9D358.
PeptideAtlasiQ9D358.
PRIDEiQ9D358.

2D gel databases

REPRODUCTION-2DPAGEQ9D358.

PTM databases

iPTMnetiQ9D358.
PhosphoSitePlusiQ9D358.

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain and liver and lowest levels in muscle.1 Publication

Gene expression databases

BgeeiENSMUSG00000044573.
CleanExiMM_ACP1.
ExpressionAtlasiQ9D358. baseline and differential.
GenevisibleiQ9D358. MM.

Interactioni

Subunit structurei

Interacts with the SH3 domain of SPTAN1. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi197927. 1 interactor.
IntActiQ9D358. 3 interactors.
MINTiMINT-1855654.

Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi7 – 18Combined sources12
Helixi19 – 33Combined sources15
Helixi37 – 39Combined sources3
Beta strandi40 – 49Combined sources10
Turni50 – 53Combined sources4
Helixi58 – 66Combined sources9
Helixi80 – 85Combined sources6
Beta strandi87 – 93Combined sources7
Helixi94 – 105Combined sources12
Beta strandi113 – 116Combined sources4
Helixi117 – 120Combined sources4
Helixi136 – 157Combined sources22

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P4UX-ray1.90A/B/C/D2-158[»]
ProteinModelPortaliQ9D358.
SMRiQ9D358.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00500000044891.
HOGENOMiHOG000273094.
HOVERGENiHBG007540.
InParanoidiQ9D358.
KOiK14394.
PhylomeDBiQ9D358.
TreeFamiTF353727.

Family and domain databases

CDDicd00115. LMWPc. 1 hit.
InterProiIPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view]
PANTHERiPTHR11717:SF7. PTHR11717:SF7. 1 hit.
PfamiPF01451. LMWPc. 1 hit.
[Graphical view]
PRINTSiPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTiSM00226. LMWPc. 1 hit.
[Graphical view]
SUPFAMiSSF52788. SSF52788. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9D358-1) [UniParc]FASTAAdd to basket
Also known as: m-IF11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDEKVSDNW RIDSAATSTY
60 70 80 90 100
EVGNPPDYRG QNCMRKHGIH MQHIARQITK EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKNC KAKIELLGSY DPQKQLIIED PYYGNDSDFE VVYQQCLRCC

KAFLEKTY
Length:158
Mass (Da):18,192
Last modified:January 23, 2007 - v3
Checksum:iA374BE5C183226AE
GO
Isoform 21 Publication (identifier: Q9D358-2) [UniParc]FASTAAdd to basket
Also known as: m-IF21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVSCLRNRGISTAHK

Show »
Length:158
Mass (Da):17,941
Checksum:iA2A1AF4BF774889E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti14L → P.1 Publication1
Natural varianti157T → P.1 Publication1
Isoform 21 Publication (identifier: Q9D358-2)
Natural varianti67R → H.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05072641 – 74RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VSCLRNRGISTAHK in isoform 2. 3 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y17343 mRNA. Translation: CAA76753.1.
Y17344 mRNA. Translation: CAA76754.1.
Y17345 mRNA. Translation: CAA76755.1.
AK014603 mRNA. Translation: BAB29458.1.
AK018329 mRNA. Translation: BAB31164.1.
AK019186 mRNA. Translation: BAB31593.1.
AK082955 mRNA. Translation: BAC38707.1.
BC039744 mRNA. Translation: AAH39744.1.
CCDSiCCDS36427.1. [Q9D358-1]
CCDS49045.1. [Q9D358-2]
RefSeqiNP_001103709.1. NM_001110239.1.
NP_067305.2. NM_021330.4. [Q9D358-1]
UniGeneiMm.359831.

Genome annotation databases

EnsembliENSMUST00000062740; ENSMUSP00000106509; ENSMUSG00000044573. [Q9D358-1]
GeneIDi11431.
KEGGimmu:11431.
UCSCiuc007ngw.2. mouse. [Q9D358-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y17343 mRNA. Translation: CAA76753.1.
Y17344 mRNA. Translation: CAA76754.1.
Y17345 mRNA. Translation: CAA76755.1.
AK014603 mRNA. Translation: BAB29458.1.
AK018329 mRNA. Translation: BAB31164.1.
AK019186 mRNA. Translation: BAB31593.1.
AK082955 mRNA. Translation: BAC38707.1.
BC039744 mRNA. Translation: AAH39744.1.
CCDSiCCDS36427.1. [Q9D358-1]
CCDS49045.1. [Q9D358-2]
RefSeqiNP_001103709.1. NM_001110239.1.
NP_067305.2. NM_021330.4. [Q9D358-1]
UniGeneiMm.359831.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P4UX-ray1.90A/B/C/D2-158[»]
ProteinModelPortaliQ9D358.
SMRiQ9D358.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi197927. 1 interactor.
IntActiQ9D358. 3 interactors.
MINTiMINT-1855654.

Chemistry databases

ChEMBLiCHEMBL3593153.

PTM databases

iPTMnetiQ9D358.
PhosphoSitePlusiQ9D358.

2D gel databases

REPRODUCTION-2DPAGEQ9D358.

Proteomic databases

EPDiQ9D358.
PeptideAtlasiQ9D358.
PRIDEiQ9D358.

Protocols and materials databases

DNASUi11431.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000062740; ENSMUSP00000106509; ENSMUSG00000044573. [Q9D358-1]
GeneIDi11431.
KEGGimmu:11431.
UCSCiuc007ngw.2. mouse. [Q9D358-1]

Organism-specific databases

CTDi52.
MGIiMGI:87881. Acp1.

Phylogenomic databases

GeneTreeiENSGT00500000044891.
HOGENOMiHOG000273094.
HOVERGENiHBG007540.
InParanoidiQ9D358.
KOiK14394.
PhylomeDBiQ9D358.
TreeFamiTF353727.

Miscellaneous databases

PROiQ9D358.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000044573.
CleanExiMM_ACP1.
ExpressionAtlasiQ9D358. baseline and differential.
GenevisibleiQ9D358. MM.

Family and domain databases

CDDicd00115. LMWPc. 1 hit.
InterProiIPR023485. Ptyr_pPase_SF.
IPR002115. Tyr_Pase_low_mol_wt_mml.
IPR017867. Tyr_phospatase_low_mol_wt.
[Graphical view]
PANTHERiPTHR11717:SF7. PTHR11717:SF7. 1 hit.
PfamiPF01451. LMWPc. 1 hit.
[Graphical view]
PRINTSiPR00719. LMWPTPASE.
PR00720. MAMMALPTPASE.
SMARTiSM00226. LMWPc. 1 hit.
[Graphical view]
SUPFAMiSSF52788. SSF52788. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPPAC_MOUSE
AccessioniPrimary (citable) accession number: Q9D358
Secondary accession number(s): O88739, O88740, Q9QWF5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 132 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.