Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9D358

- PPAC_MOUSE

UniProt

Q9D358 - PPAC_MOUSE

Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

Acp1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 3 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.By similarity

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.By similarity
    A phosphate monoester + H2O = an alcohol + phosphate.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei13 – 131NucleophileBy similarity
    Active sitei19 – 191By similarity
    Active sitei130 – 1301Proton donorBy similarity

    GO - Molecular functioni

    1. acid phosphatase activity Source: MGI
    2. non-membrane spanning protein tyrosine phosphatase activity Source: InterPro
    3. phosphatase activity Source: MGI

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
    Short name:
    LMW-PTP
    Short name:
    LMW-PTPase
    Alternative name(s):
    Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
    Gene namesi
    Name:Acp1
    OrganismiMus musculus (Mouse)Imported
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 12

    Organism-specific databases

    MGIiMGI:87881. Acp1.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. cytoplasmic side of plasma membrane Source: Ensembl
    3. nucleus Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 158157Low molecular weight phosphotyrosine protein phosphatasePRO_0000046559Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei132 – 1321PhosphotyrosineBy similarity
    Modified residuei133 – 1331PhosphotyrosineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9D358.
    PaxDbiQ9D358.
    PRIDEiQ9D358.

    2D gel databases

    REPRODUCTION-2DPAGEQ9D358.

    PTM databases

    PhosphoSiteiQ9D358.

    Expressioni

    Tissue specificityi

    Widely expressed with highest levels in brain and liver and lowest levels in muscle.1 Publication

    Gene expression databases

    ArrayExpressiQ9D358.
    BgeeiQ9D358.
    CleanExiMM_ACP1.
    GenevestigatoriQ9D358.

    Interactioni

    Subunit structurei

    Interacts with the SH3 domain of SPTAN1. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi197927. 1 interaction.
    IntActiQ9D358. 2 interactions.
    MINTiMINT-1855654.

    Structurei

    Secondary structure

    1
    158
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi7 – 1812
    Helixi19 – 3315
    Helixi37 – 393
    Beta strandi40 – 4910
    Turni50 – 534
    Helixi58 – 669
    Helixi80 – 856
    Beta strandi87 – 937
    Helixi94 – 10512
    Beta strandi113 – 1164
    Helixi117 – 1204
    Helixi136 – 15722

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2P4UX-ray1.90A/B/C/D2-158[»]
    ProteinModelPortaliQ9D358.
    SMRiQ9D358. Positions 6-158.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG0394.
    GeneTreeiENSGT00500000044891.
    HOGENOMiHOG000273094.
    HOVERGENiHBG007540.
    InParanoidiQ9D358.
    KOiK14394.
    OrthoDBiEOG7QZGCG.
    PhylomeDBiQ9D358.
    TreeFamiTF353727.

    Family and domain databases

    InterProiIPR023485. Ptyr_pPase_SF.
    IPR002115. Tyr_Pase_low_mol_wt_mml.
    IPR000106. Tyr_phospatase/Ars_reductase.
    IPR017867. Tyr_phospatase_low_mol_wt.
    [Graphical view]
    PANTHERiPTHR11717. PTHR11717. 1 hit.
    PfamiPF01451. LMWPc. 1 hit.
    [Graphical view]
    PRINTSiPR00719. LMWPTPASE.
    PR00720. MAMMALPTPASE.
    SMARTiSM00226. LMWPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF52788. SSF52788. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q9D358-1) [UniParc]FASTAAdd to Basket

    Also known as: m-IF11 Publication

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDEKVSDNW RIDSAATSTY    50
    EVGNPPDYRG QNCMRKHGIH MQHIARQITK EDFATFDYIL CMDESNLRDL 100
    NRKSNQVKNC KAKIELLGSY DPQKQLIIED PYYGNDSDFE VVYQQCLRCC 150
    KAFLEKTY 158
    Length:158
    Mass (Da):18,192
    Last modified:January 23, 2007 - v3
    Checksum:iA374BE5C183226AE
    GO
    Isoform 21 Publication (identifier: Q9D358-2) [UniParc]FASTAAdd to Basket

    Also known as: m-IF21 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         41-74: RIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVSCLRNRGISTAHK

    Show »
    Length:158
    Mass (Da):17,941
    Checksum:iA2A1AF4BF774889E
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti14 – 141L → P.1 Publication
    Natural varianti157 – 1571T → P.1 Publication
    Isoform 21 Publication (identifier: Q9D358-2)
    Natural varianti67 – 671R → H.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei41 – 7434RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VSCLRNRGISTAHK in isoform 2. 3 PublicationsVSP_050726Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y17343 mRNA. Translation: CAA76753.1.
    Y17344 mRNA. Translation: CAA76754.1.
    Y17345 mRNA. Translation: CAA76755.1.
    AK014603 mRNA. Translation: BAB29458.1.
    AK018329 mRNA. Translation: BAB31164.1.
    AK019186 mRNA. Translation: BAB31593.1.
    AK082955 mRNA. Translation: BAC38707.1.
    BC039744 mRNA. Translation: AAH39744.1.
    CCDSiCCDS36427.1. [Q9D358-1]
    CCDS49045.1. [Q9D358-2]
    RefSeqiNP_001103709.1. NM_001110239.1.
    NP_067305.2. NM_021330.4. [Q9D358-1]
    XP_006542863.1. XM_006542800.1. [Q9D358-1]
    UniGeneiMm.359831.

    Genome annotation databases

    EnsembliENSMUST00000062740; ENSMUSP00000106509; ENSMUSG00000044573. [Q9D358-1]
    GeneIDi102642088.
    11431.
    KEGGimmu:102642088.
    mmu:11431.
    UCSCiuc007ngw.2. mouse. [Q9D358-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y17343 mRNA. Translation: CAA76753.1 .
    Y17344 mRNA. Translation: CAA76754.1 .
    Y17345 mRNA. Translation: CAA76755.1 .
    AK014603 mRNA. Translation: BAB29458.1 .
    AK018329 mRNA. Translation: BAB31164.1 .
    AK019186 mRNA. Translation: BAB31593.1 .
    AK082955 mRNA. Translation: BAC38707.1 .
    BC039744 mRNA. Translation: AAH39744.1 .
    CCDSi CCDS36427.1. [Q9D358-1 ]
    CCDS49045.1. [Q9D358-2 ]
    RefSeqi NP_001103709.1. NM_001110239.1.
    NP_067305.2. NM_021330.4. [Q9D358-1 ]
    XP_006542863.1. XM_006542800.1. [Q9D358-1 ]
    UniGenei Mm.359831.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2P4U X-ray 1.90 A/B/C/D 2-158 [» ]
    ProteinModelPortali Q9D358.
    SMRi Q9D358. Positions 6-158.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 197927. 1 interaction.
    IntActi Q9D358. 2 interactions.
    MINTi MINT-1855654.

    PTM databases

    PhosphoSitei Q9D358.

    2D gel databases

    REPRODUCTION-2DPAGE Q9D358.

    Proteomic databases

    MaxQBi Q9D358.
    PaxDbi Q9D358.
    PRIDEi Q9D358.

    Protocols and materials databases

    DNASUi 11431.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000062740 ; ENSMUSP00000106509 ; ENSMUSG00000044573 . [Q9D358-1 ]
    GeneIDi 102642088.
    11431.
    KEGGi mmu:102642088.
    mmu:11431.
    UCSCi uc007ngw.2. mouse. [Q9D358-1 ]

    Organism-specific databases

    CTDi 52.
    MGIi MGI:87881. Acp1.

    Phylogenomic databases

    eggNOGi COG0394.
    GeneTreei ENSGT00500000044891.
    HOGENOMi HOG000273094.
    HOVERGENi HBG007540.
    InParanoidi Q9D358.
    KOi K14394.
    OrthoDBi EOG7QZGCG.
    PhylomeDBi Q9D358.
    TreeFami TF353727.

    Miscellaneous databases

    NextBioi 278712.
    PROi Q9D358.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9D358.
    Bgeei Q9D358.
    CleanExi MM_ACP1.
    Genevestigatori Q9D358.

    Family and domain databases

    InterProi IPR023485. Ptyr_pPase_SF.
    IPR002115. Tyr_Pase_low_mol_wt_mml.
    IPR000106. Tyr_phospatase/Ars_reductase.
    IPR017867. Tyr_phospatase_low_mol_wt.
    [Graphical view ]
    PANTHERi PTHR11717. PTHR11717. 1 hit.
    Pfami PF01451. LMWPc. 1 hit.
    [Graphical view ]
    PRINTSi PR00719. LMWPTPASE.
    PR00720. MAMMALPTPASE.
    SMARTi SM00226. LMWPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52788. SSF52788. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of murine low molecular weight phosphotyrosine protein phosphatase cDNA: identification of a new isoform."
      Magherini F., Giannoni E., Raugei G., Cirri P., Paoli P., Modesti A., Camici G., Ramponi G.
      FEBS Lett. 437:263-266(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, VARIANTS PRO-14 AND PRO-157.
      Tissue: LiverImported.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Cerebellum, Embryo, Skin and Spinal cord.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: FVB/NImported.
    4. Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 2-158.

    Entry informationi

    Entry nameiPPAC_MOUSE
    AccessioniPrimary (citable) accession number: Q9D358
    Secondary accession number(s): O88739, O88740, Q9QWF5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 26, 2004
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 112 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3