Reviewed,
UniProtKB/Swiss-Prot Q9D358 (PPAC_MOUSE)
Last modified
November 3, 2009.
Version 68.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Low molecular weight phosphotyrosine protein phosphatase Short name=LMW-PTPase Short name=LMW-PTP EC=3.1.3.48 Alternative name(s): Low molecular weight cytosolic acid phosphatase EC=3.1.3.2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 158 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates By similarity. UniProtKB P11064 |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. UniProtKB P11064 A phosphate monoester + H2O = an alcohol + phosphate. |
| Subunit structure | Isoform 1 interacts with the SH3 domain of SPTAN1 By similarity. UniProtKB P41498 |
| Subcellular location | Cytoplasm By similarity. UniProtKB P41498 |
| Tissue specificity | Widely expressed with highest levels in brain and liver and lowest levels in muscle. Ref.1 |
| Sequence similarities | Belongs to the low molecular weight phosphotyrosine protein phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Acetylation Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | protein amino acid dephosphorylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | acid phosphatase activity Inferred from direct assay. Source: MGI non-membrane spanning protein tyrosine phosphatase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 Ref.1 (identifier: Q9D358-1) Also known as: m-IF1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 Ref.1 (identifier: Q9D358-2) Also known as: m-IF2; The sequence of this isoform differs from the canonical sequence as follows: 41-74: RIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVSCLRNRGISTAHK | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 67 | 1 | R → H | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity UniProtKB P41498 | ||||||
| Chain | 2 – 158 | 157 | Low molecular weight phosphotyrosine protein phosphatase | PRO_0000046559 | |||||
Sites | |||||||||
| Active site | 13 | 1 | Nucleophile By similarity UniProtKB P11064 | ||||||
| Active site | 19 | 1 | By similarity UniProtKB P11064 | ||||||
| Active site | 130 | 1 | Proton donor By similarity UniProtKB P11064 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity UniProtKB P41498 | ||||||
| Modified residue | 132 | 1 | Phosphotyrosine By similarity UniProtKB P24666 | ||||||
| Modified residue | 133 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 156 | 1 | N6-acetyllysine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 41 – 74 | 34 | RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VSCLRNRGISTAHK in isoform 2. Ref.1 | VSP_050726 | |||||
| Natural variant | 14 | 1 | L → P Ref.1 | ||||||
| Natural variant | 157 | 1 | T → P Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of murine low molecular weight phosphotyrosine protein phosphatase cDNA: identification of a new isoform." Magherini F., Giannoni E., Raugei G., Cirri P., Paoli P., Modesti A., Camici G., Ramponi G. FEBS Lett. 437:263-266(1998) [PubMed: 9824304] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, VARIANTS PRO-14 AND PRO-157. Tissue: Liver. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Cerebellum, Embryo, Skin and Spinal cord. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: FVB/N. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Y17343 mRNA. Translation: CAA76753.1. Y17344 mRNA. Translation: CAA76754.1. Y17345 mRNA. Translation: CAA76755.1. AK014603 mRNA. Translation: BAB29458.1. AK018329 mRNA. Translation: BAB31164.1. AK019186 mRNA. Translation: BAB31593.1. AK082955 mRNA. Translation: BAC38707.1. BC039744 mRNA. Translation: AAH39744.1. | |
| IPI | IPI00134135. IPI00828470. |
| RefSeq | NP_001103709.1. NP_067305.2. XP_910741.1. |
| UniGene | Mm.359831 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1PHR based on UniProtKB P11064. |
| SMR | Q9D358. Positions 2-158. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9D358. |
PTM databases | |
| PhosphoSite | Q9D358. |
2-D gel databases | |
| REPRODUCTION-2DPAGE | Q9D358. |
Proteomic databases | |
| PRIDE | Q9D358. |
Genome annotation databases | |
| Ensembl | ENSMUST00000062740; ENSMUSP00000106509; ENSMUSG00000044573; Mus musculus. [Genome view] ENSMUST00000074038; ENSMUSP00000073686; ENSMUSG00000044573; Mus musculus. [Genome view] |
| GeneID | 11431. 631286. |
| KEGG | mmu:11431. mmu:631286. |
| UCSC | uc007ngw.1. mouse. |
Organism-specific databases | |
| CTD | 11431. |
| MGI | MGI:87881. Acp1. |
Phylogenomic databases | |
| HOGENOM | Q9D358. |
| HOVERGEN | Q9D358. |
| OMA | CHGNICR. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.2. 244. 3.1.3.48. 244. |
Gene expression databases | |
| ArrayExpress | Q9D358. |
| Bgee | Q9D358. |
| CleanEx | MM_ACP1. |
| Genevestigator | Q9D358. |
| GermOnline | ENSMUSG00000059722. Mus musculus. |
Family and domain databases | |
| InterPro | IPR002115. Tyr_Pase_low_mol_wt_mml. IPR000106. Tyr_phospatase/Ars_reductase. IPR017867. Tyr_phospatase_low_mol_wt. [Graphical view] |
| PANTHER | PTHR11717. Low_mwt_PTPase. 1 hit. |
| Pfam | PF01451. LMWPc. 1 hit. [Graphical view] |
| PRINTS | PR00719. LMWPTPASE. PR00720. MAMMALPTPASE. |
| SMART | SM00226. LMWPc. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 278712. |
| SOURCE | Search... |
Entry information
| Entry name | PPAC_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9D358 Secondary accession number(s): O88739, O88740, Q9QWF5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


