Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adenylate kinase 7

Gene

Ak7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. Also displays broad nucleoside diphosphate kinase activity. Involved in maintaining ciliary structure and function.1 Publication

Catalytic activityi

ATP + AMP = 2 ADP.By similarity
ATP + nucleoside diphosphate = ADP + nucleoside triphosphate.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei380AMPBy similarity1
Binding sitei446AMPBy similarity1
Binding sitei478ATP; via carbonyl oxygenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi268 – 273ATPBy similarity6
Nucleotide bindingi323 – 346AMPBy similarityAdd BLAST24
Nucleotide bindingi373 – 376AMPBy similarity4

GO - Molecular functioni

GO - Biological processi

  • axoneme assembly Source: MGI
  • brain development Source: MGI
  • epithelial cilium movement Source: MGI
  • inflammatory response to antigenic stimulus Source: MGI
  • nucleoside diphosphate phosphorylation Source: UniProtKB
  • nucleoside triphosphate biosynthetic process Source: UniProtKB
  • spermatogenesis Source: MGI

Keywordsi

Molecular functionKinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Adenylate kinase 7 (EC:2.7.4.3By similarity, EC:2.7.4.6By similarity)
Short name:
AK 7
Alternative name(s):
ATP-AMP transphosphorylase 7
Gene namesi
Name:Ak7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1926051. Ak7.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

Mutant mice present pathological signs characteristic of primary ciliary dyskinesia (PCD), including high prevalence of microtubular defects, significantly decreased ciliary beat frequency, hydrocephalus, abnormal spermatogenesis, mucus accumulation in the paranasal passages, and exacerbated respiratory responses upon allergen challenge. This phenotype arose serendipitously in the process of generating transgenic mice harboring a heme oxygenase 1 construct, due to the serendipitous disruption of Ak7 locus by the transgene insertion event.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001589541 – 614Adenylate kinase 7Add BLAST614

Proteomic databases

MaxQBiQ9D2H2.
PaxDbiQ9D2H2.
PRIDEiQ9D2H2.

PTM databases

iPTMnetiQ9D2H2.
PhosphoSitePlusiQ9D2H2.

Expressioni

Gene expression databases

CleanExiMM_AK7.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043145.

Structurei

3D structure databases

ProteinModelPortaliQ9D2H2.
SMRiQ9D2H2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni258 – 503Adenylate kinaseBy similarityAdd BLAST246
Regioni288 – 346NMPbindBy similarityAdd BLAST59
Regioni428 – 438LIDBy similarityAdd BLAST11
Regioni570 – 614DPY-30By similarityAdd BLAST45

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili376 – 568Sequence analysisAdd BLAST193

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi311 – 565Glu-richAdd BLAST255
Compositional biasi311 – 323Poly-GluAdd BLAST13
Compositional biasi388 – 395Poly-Glu8

Sequence similaritiesi

In the central section; belongs to the adenylate kinase family.Curated
In the C-terminal section; belongs to the dpy-30 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3078. Eukaryota.
COG0563. LUCA.
HOGENOMiHOG000007764.
HOVERGENiHBG045568.
InParanoidiQ9D2H2.
KOiK00939.
PhylomeDBiQ9D2H2.

Family and domain databases

CDDicd01428. ADK. 1 hit.
InterProiView protein in InterPro
IPR000850. Adenylat/UMP-CMP_kin.
IPR026867. AK7.
IPR007858. Dpy-30_motif.
IPR016040. NAD(P)-bd_dom.
IPR027417. P-loop_NTPase.
PANTHERiPTHR23359. PTHR23359. 1 hit.
PTHR23359:SF133. PTHR23359:SF133. 1 hit.
PfamiView protein in Pfam
PF05186. Dpy-30. 1 hit.
SUPFAMiSSF51735. SSF51735. 1 hit.
SSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D2H2-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MECDAVIYNI TENVQQVEEA LWAVSALNEE ISHFEKRKVF ILLSTVMTWA
60 70 80 90 100
RSKPLDPDDN EVPFTEEDYR RRKHHPNFLD HINAEKIVLK FGKNAKKFAT
110 120 130 140 150
YVVASGLQYG AEGGILHTFF KMAWLGEVPA LPVFGDGTNC IPAIHVVDLA
160 170 180 190 200
GVIQNIIDHV PKLHYLVAVD EAVHTLEDLV KCISKNTGPG KIQKVPKENA
210 220 230 240 250
FLTKDLTQEY LDHLLVNLRM EALFVKENFN IRWVAQTGFV ENINSILKEY
260 270 280 290 300
KQSRGLLPIK ICILGPPAVG KSSISEELAK YYKLHHIKMK DVIAEAIAKL
310 320 330 340 350
EAIVAPKDSV EGEEEGEEEE EEENVDDAQE LLDGIKESME QNAGRLEDQY
360 370 380 390 400
IIRFVKEKLK SMPCRNQGFI LDGFPKTYDQ AKDLFNQEEE EEEEEIRGKI
410 420 430 440 450
FPYDKLITPE FVCGLDASDE FLKERVMNLP ESVVAGTHYS QDRFLRSLSH
460 470 480 490 500
YRDINTDDET VFNYFDELEI HPIHIDVGKL EDAQNRLAIK QLIKEIGKPR
510 520 530 540 550
NYGLTDEEKA EEEKKAAEER LAKEAAQTAE LEHKEAMEMA EKIARWEEWN
560 570 580 590 600
KRLEEVKREE RELLEVQSVP LRNYLMTYVM PTLMQGLNEC CKVRPEDPVD
610
FLAEYLFKNN PEMQ
Length:614
Mass (Da):70,675
Last modified:June 1, 2001 - v1
Checksum:i0ABA0DC6C7CE5E8B
GO
Isoform 2 (identifier: Q9D2H2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MECDAVIYNITENVQQVEEALWAVSALNEEISHFEKRKVFILLSTVMTWARSKPLDP → M
     181-206: KCISKNTGPGKIQKVPKENAFLTKDL → KVCVLTPCRASLSSCTLWMLVTDFLC
     207-614: Missing.

Note: No experimental confirmation available.
Show »
Length:150
Mass (Da):16,734
Checksum:i758CF854E92D94B1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0084741 – 57MECDA…KPLDP → M in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_008475181 – 206KCISK…LTKDL → KVCVLTPCRASLSSCTLWML VTDFLC in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_008476207 – 614Missing in isoform 2. 1 PublicationAdd BLAST408

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019664 mRNA. Translation: BAB31828.1.
AK078221 mRNA. Translation: BAC37180.1.
RefSeqiNP_084463.1. NM_030187.1.
UniGeneiMm.36006.

Genome annotation databases

GeneIDi78801.
KEGGimmu:78801.
UCSCiuc007oyu.1. mouse. [Q9D2H2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKAD7_MOUSE
AccessioniPrimary (citable) accession number: Q9D2H2
Secondary accession number(s): Q8BVH3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: June 1, 2001
Last modified: August 30, 2017
This is version 124 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families