Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adenylate kinase 7

Gene

Ak7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. Also displays broad nucleoside diphosphate kinase activity. Involved in maintaining ciliary structure and function.1 Publication

Catalytic activityi

ATP + AMP = 2 ADP.By similarity
ATP + nucleoside diphosphate = ADP + nucleoside triphosphate.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei380 – 3801AMPBy similarity
Binding sitei446 – 4461AMPBy similarity
Binding sitei478 – 4781ATP; via carbonyl oxygenBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi268 – 2736ATPBy similarity
Nucleotide bindingi323 – 34624AMPBy similarityAdd
BLAST
Nucleotide bindingi373 – 3764AMPBy similarity

GO - Molecular functioni

GO - Biological processi

  • axoneme assembly Source: MGI
  • brain development Source: MGI
  • epithelial cilium movement Source: MGI
  • inflammatory response to antigenic stimulus Source: MGI
  • nucleoside diphosphate phosphorylation Source: UniProtKB
  • nucleoside triphosphate biosynthetic process Source: UniProtKB
  • spermatogenesis Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Biological processi

Cilium biogenesis/degradation

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Adenylate kinase 7 (EC:2.7.4.3By similarity, EC:2.7.4.6By similarity)
Short name:
AK 7
Alternative name(s):
ATP-AMP transphosphorylase 7
Gene namesi
Name:Ak7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1926051. Ak7.

Subcellular locationi

  • Cytoplasmcytosol By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Disruption phenotypei

Mutant mice present pathological signs characteristic of primary ciliary dyskinesia (PCD), including high prevalence of microtubular defects, significantly decreased ciliary beat frequency, hydrocephalus, abnormal spermatogenesis, mucus accumulation in the paranasal passages, and exacerbated respiratory responses upon allergen challenge. This phenotype arose serendipitously in the process of generating transgenic mice harboring a heme oxygenase 1 construct, due to the serendipitous disruption of Ak7 locus by the transgene insertion event.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 614614Adenylate kinase 7PRO_0000158954Add
BLAST

Proteomic databases

MaxQBiQ9D2H2.
PaxDbiQ9D2H2.
PRIDEiQ9D2H2.

PTM databases

PhosphoSiteiQ9D2H2.

Expressioni

Gene expression databases

BgeeiQ9D2H2.
CleanExiMM_AK7.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043145.

Structurei

3D structure databases

ProteinModelPortaliQ9D2H2.
SMRiQ9D2H2. Positions 258-439, 567-612.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni258 – 503246Adenylate kinaseBy similarityAdd
BLAST
Regioni288 – 34659NMPbindBy similarityAdd
BLAST
Regioni428 – 43811LIDBy similarityAdd
BLAST
Regioni570 – 61445DPY-30By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili376 – 568193Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi311 – 565255Glu-richAdd
BLAST
Compositional biasi311 – 32313Poly-GluAdd
BLAST
Compositional biasi388 – 3958Poly-Glu

Sequence similaritiesi

In the central section; belongs to the adenylate kinase family.Curated
In the C-terminal section; belongs to the dpy-30 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3078. Eukaryota.
COG0563. LUCA.
HOGENOMiHOG000007764.
HOVERGENiHBG045568.
InParanoidiQ9D2H2.
KOiK00939.
PhylomeDBiQ9D2H2.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
3.40.50.720. 1 hit.
InterProiIPR000850. Adenylat/UMP-CMP_kin.
IPR007858. Dpy-30_motif.
IPR016040. NAD(P)-bd_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR23359. PTHR23359. 3 hits.
PfamiPF05186. Dpy-30. 1 hit.
[Graphical view]
SUPFAMiSSF51735. SSF51735. 1 hit.
SSF52540. SSF52540. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D2H2-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MECDAVIYNI TENVQQVEEA LWAVSALNEE ISHFEKRKVF ILLSTVMTWA
60 70 80 90 100
RSKPLDPDDN EVPFTEEDYR RRKHHPNFLD HINAEKIVLK FGKNAKKFAT
110 120 130 140 150
YVVASGLQYG AEGGILHTFF KMAWLGEVPA LPVFGDGTNC IPAIHVVDLA
160 170 180 190 200
GVIQNIIDHV PKLHYLVAVD EAVHTLEDLV KCISKNTGPG KIQKVPKENA
210 220 230 240 250
FLTKDLTQEY LDHLLVNLRM EALFVKENFN IRWVAQTGFV ENINSILKEY
260 270 280 290 300
KQSRGLLPIK ICILGPPAVG KSSISEELAK YYKLHHIKMK DVIAEAIAKL
310 320 330 340 350
EAIVAPKDSV EGEEEGEEEE EEENVDDAQE LLDGIKESME QNAGRLEDQY
360 370 380 390 400
IIRFVKEKLK SMPCRNQGFI LDGFPKTYDQ AKDLFNQEEE EEEEEIRGKI
410 420 430 440 450
FPYDKLITPE FVCGLDASDE FLKERVMNLP ESVVAGTHYS QDRFLRSLSH
460 470 480 490 500
YRDINTDDET VFNYFDELEI HPIHIDVGKL EDAQNRLAIK QLIKEIGKPR
510 520 530 540 550
NYGLTDEEKA EEEKKAAEER LAKEAAQTAE LEHKEAMEMA EKIARWEEWN
560 570 580 590 600
KRLEEVKREE RELLEVQSVP LRNYLMTYVM PTLMQGLNEC CKVRPEDPVD
610
FLAEYLFKNN PEMQ
Length:614
Mass (Da):70,675
Last modified:June 1, 2001 - v1
Checksum:i0ABA0DC6C7CE5E8B
GO
Isoform 2 (identifier: Q9D2H2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MECDAVIYNITENVQQVEEALWAVSALNEEISHFEKRKVFILLSTVMTWARSKPLDP → M
     181-206: KCISKNTGPGKIQKVPKENAFLTKDL → KVCVLTPCRASLSSCTLWMLVTDFLC
     207-614: Missing.

Note: No experimental confirmation available.
Show »
Length:150
Mass (Da):16,734
Checksum:i758CF854E92D94B1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5757MECDA…KPLDP → M in isoform 2. 1 PublicationVSP_008474Add
BLAST
Alternative sequencei181 – 20626KCISK…LTKDL → KVCVLTPCRASLSSCTLWML VTDFLC in isoform 2. 1 PublicationVSP_008475Add
BLAST
Alternative sequencei207 – 614408Missing in isoform 2. 1 PublicationVSP_008476Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019664 mRNA. Translation: BAB31828.1.
AK078221 mRNA. Translation: BAC37180.1.
RefSeqiNP_084463.1. NM_030187.1.
UniGeneiMm.36006.

Genome annotation databases

GeneIDi78801.
KEGGimmu:78801.
UCSCiuc007oyu.1. mouse. [Q9D2H2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019664 mRNA. Translation: BAB31828.1.
AK078221 mRNA. Translation: BAC37180.1.
RefSeqiNP_084463.1. NM_030187.1.
UniGeneiMm.36006.

3D structure databases

ProteinModelPortaliQ9D2H2.
SMRiQ9D2H2. Positions 258-439, 567-612.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043145.

PTM databases

PhosphoSiteiQ9D2H2.

Proteomic databases

MaxQBiQ9D2H2.
PaxDbiQ9D2H2.
PRIDEiQ9D2H2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi78801.
KEGGimmu:78801.
UCSCiuc007oyu.1. mouse. [Q9D2H2-1]

Organism-specific databases

CTDi122481.
MGIiMGI:1926051. Ak7.

Phylogenomic databases

eggNOGiKOG3078. Eukaryota.
COG0563. LUCA.
HOGENOMiHOG000007764.
HOVERGENiHBG045568.
InParanoidiQ9D2H2.
KOiK00939.
PhylomeDBiQ9D2H2.

Miscellaneous databases

NextBioi349542.
PROiQ9D2H2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9D2H2.
CleanExiMM_AK7.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
3.40.50.720. 1 hit.
InterProiIPR000850. Adenylat/UMP-CMP_kin.
IPR007858. Dpy-30_motif.
IPR016040. NAD(P)-bd_dom.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR23359. PTHR23359. 3 hits.
PfamiPF05186. Dpy-30. 1 hit.
[Graphical view]
SUPFAMiSSF51735. SSF51735. 1 hit.
SSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Olfactory bulb and Testis.
  2. "Mutation of murine adenylate kinase 7 underlies a primary ciliary dyskinesia phenotype."
    Fernandez-Gonzalez A., Kourembanas S., Wyatt T.A., Mitsialis S.A.
    Am. J. Respir. Cell Mol. Biol. 40:305-313(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE, FUNCTION.
  3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Testis.

Entry informationi

Entry nameiKAD7_MOUSE
AccessioniPrimary (citable) accession number: Q9D2H2
Secondary accession number(s): Q8BVH3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: June 1, 2001
Last modified: April 13, 2016
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.