Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptojanin-2

Gene

Synj2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inositol 5-phosphatase which may be involved in distinct membrane trafficking and signal transduction pathways. May mediate the inhibitory effect of Rac1 on endocytosis (By similarity).By similarity1 Publication

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 4-phosphate + phosphate.1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiR-MMU-1660499. Synthesis of PIPs at the plasma membrane.
R-MMU-8856828. Clathrin-mediated endocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptojanin-2 (EC:3.1.3.361 Publication)
Alternative name(s):
Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 2
Gene namesi
Name:Synj2
Synonyms:Kiaa0348
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1201671. Synj2.

Subcellular locationi

  • Cytoplasm By similarity
  • Cell membrane By similarity
  • Cell projectionaxon By similarity
  • Cytoplasmcytoskeleton By similarity
  • Membrane raft By similarity

  • Note: Localizes at nerve terminals in brain and at bundles of microtubules surrounding the nucleus in the elongating spermatids corresponding to the manchette. Translocates from the cytoplasm to membrane ruffles in a RAC1-dependent manner.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002097341 – 1434Synaptojanin-2Add BLAST1434

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1077PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9D2G5.
PeptideAtlasiQ9D2G5.
PRIDEiQ9D2G5.

PTM databases

iPTMnetiQ9D2G5.
PhosphoSitePlusiQ9D2G5.

Expressioni

Tissue specificityi

Ubiquitously expressed, with the highest levels in heart and brain. Detected in cortex, cerebellum and olfactory bulb. Expressed in the testis.2 Publications

Gene expression databases

BgeeiENSMUSG00000023805.
CleanExiMM_SYNJ2.
ExpressionAtlasiQ9D2G5. baseline and differential.
GenevisibleiQ9D2G5. MM.

Interactioni

Subunit structurei

Binds GRB2 and OMP25.By similarity

Protein-protein interaction databases

IntActiQ9D2G5. 1 interactor.
STRINGi10090.ENSMUSP00000111457.

Structurei

3D structure databases

ProteinModelPortaliQ9D2G5.
SMRiQ9D2G5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini120 – 444SACPROSITE-ProRule annotationAdd BLAST325
Domaini889 – 968RRMPROSITE-ProRule annotationAdd BLAST80

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni450 – ?CatalyticBy similarity

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1144 – 1281Pro-richAdd BLAST138

Domaini

The C-terminal proline-rich region mediates binding to the SH3 domain-containing protein GRB2.

Sequence similaritiesi

Belongs to the synaptojanin family.Curated
In the central section; belongs to the inositol 1,4,5-trisphosphate 5-phosphatase family.Curated
Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation
Contains 1 SAC domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0566. Eukaryota.
COG5329. LUCA.
COG5411. LUCA.
GeneTreeiENSGT00760000119075.
HOVERGENiHBG079225.
InParanoidiQ9D2G5.
KOiK20279.
PhylomeDBiQ9D2G5.
TreeFamiTF354311.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
3.60.10.10. 1 hit.
InterProiIPR015047. DUF1866.
IPR005135. Endo/exonuclease/phosphatase.
IPR000300. IPPc.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR002013. SAC_dom.
[Graphical view]
PfamiPF08952. DUF1866. 1 hit.
PF03372. Exo_endo_phos. 1 hit.
PF02383. Syja_N. 1 hit.
[Graphical view]
SMARTiSM01165. DUF1866. 1 hit.
SM00128. IPPc. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
SSF56219. SSF56219. 2 hits.
PROSITEiPS50102. RRM. 1 hit.
PS50275. SAC. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D2G5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALSKGLRLL ARLDPTGPSS VLLEARGRGD CLLFEAGAVA TLAPEEKEVI
60 70 80 90 100
KGLYSKLTDA YGCLGELRLQ SGGVPLSFLV LVTGCMSVGR IPDAEIYKIT
110 120 130 140 150
ATELYPLQEE AKEEDRLPTL KKILSSGVFY FAWPNDGACF DLTIRAQKQG
160 170 180 190 200
DDGSEWGTSF FWNQLLHVPL RQHQVNCHNW LLKVICGVVT IRTVYASHKQ
210 220 230 240 250
AKACLISRIS CERAGARFLT RGVNDDGHVS NFVETEQTIY MDDGVSSFVQ
260 270 280 290 300
IRGSVPLFWE QPGLQVGSHH LRLHRGLEAN APAFERHMVL LKEQYGKQVV
310 320 330 340 350
VNLLGSRGGE EVLNRAFKKL LWASCHAGDT PMINFDFHQF AKGRKLEKLE
360 370 380 390 400
NLLRPQLQLH WEDFGVFAKG ENVSPRFQKG TLRMNCLDCL DRTNTVQCFI
410 420 430 440 450
ALEVLHLQLE SLGLNSKPII DRFVESFKAM WSLNGHSLSK VFTGSRALEG
460 470 480 490 500
KAKVGKLKDG ARSMSRTIQS NFFDGVKQEA IKLLLVGDVY NEESTDKGRM
510 520 530 540 550
LLDNTALLAT PRILKAMTER QSEFTNFKRI QIAVGTWNVN GGKQFRSNLL
560 570 580 590 600
GTAELTDWLL DAPQLSGAVD SQDDGSPADV FAIGFEEMVE LSAGNIVNAS
610 620 630 640 650
TTNRKMWGEQ LQKAISRSHR YILLTSAQLV GVCLYIFVRP YHVPFIRDVA
660 670 680 690 700
IDTVKTGMGG KAGNKGAVGI RFQLHSTSFC FVCSHLTAGQ SQVKERNEDY
710 720 730 740 750
REITHKLSFP SGRNIFSHDY VFWCGDFNYR IDLTYEEVFY FVKRQDWKKL
760 770 780 790 800
MEFDQLQLQK SSGKIFKDFH EGAVNFGPTY KYDVGSAAYD TSDKCRTPAW
810 820 830 840 850
TDRVLWWRKK HPYDKTAGEL NLLDSDLDGD PQIRHTWSPG TLKYYGRAEL
860 870 880 890 900
QASDHRPVLA IVEVEVQEVD VGARERVFQE VSSVQGPLDA TVVVNLQSPT
910 920 930 940 950
LEEKNEFPED LRTELMQTLG NYGTIILVRI NQGQMLVTFA DSHSALSVLD
960 970 980 990 1000
VDGMKVKGRA VKIRPKTKDW LEGLREELLR KRDSMAPVSP TANSCLLEEN
1010 1020 1030 1040 1050
FDFSSLDYES EGDVLEEDED YLVDGFGQPV VSDSELGGDN SSDTMSSLTP
1060 1070 1080 1090 1100
ASKSPALAKK KQHPTYKAGL MVKKSASDAS ISSGTHGQYS ILQTAKLLPG
1110 1120 1130 1140 1150
APQQPPKART GISKPYNVKQ IKTTNAQEAE AAIRCLLEAS GGVPESAPGA
1160 1170 1180 1190 1200
IPLRNQGSSK PEATLGPPAL PRRPAPRVPT MKKPTLRRTG KPMLPEENFE
1210 1220 1230 1240 1250
PQPVHFTMAS QEMNLETPPP ITATPIPPVP KPRTLQPGKG VEGRPSSGKP
1260 1270 1280 1290 1300
EPDEAPSVTG TVESPPPEAQ EAPSLAPKVP PRRKKSAPAA FHLQVLQNNS
1310 1320 1330 1340 1350
QVLQGLTCSS SSPPSLKPDT HPLCLQVALG TSSARSPETH GPRVTEPEAA
1360 1370 1380 1390 1400
SFHGNYPDPF WSLLHHPKLL NNTWLSKSSE PLDVGSRNPE RTHTEPAQVN
1410 1420 1430
ASLAERGLPP DHGGKDLSHW VTASNKDKRT TLGV
Length:1,434
Mass (Da):158,480
Last modified:January 16, 2004 - v2
Checksum:i69FE8148A3E91827
GO
Isoform 2 (identifier: Q9D2G5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: Missing.

Note: No experimental confirmation available.
Show »
Length:1,349
Mass (Da):149,621
Checksum:i32F9E3FDA32C98EE
GO
Isoform 3 (identifier: Q9D2G5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-316: Missing.
     317-318: FK → MQ
     1106-1434: PKARTGISKP...NKDKRTTLGV → VSPLWGSQGSGQRFRPAGVVLHPKTMWISVDTRNI

Note: No experimental confirmation available.
Show »
Length:824
Mass (Da):92,285
Checksum:iBCE381F62FB82850
GO
Isoform 4 (identifier: Q9D2G5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-161: Missing.
     162-162: W → M

Note: No experimental confirmation available.
Show »
Length:1,273
Mass (Da):140,990
Checksum:iE9ADB182F47FC406
GO
Isoform 5 (identifier: Q9D2G5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1192-1434: PMLPEENFEP...NKDKRTTLGV → VYSGISQCLR...FQDLWLKFRR

Show »
Length:1,256
Mass (Da):140,129
Checksum:i4C6B04FBA36CAF2D
GO
Isoform 6 (identifier: Q9D2G5-6) [UniParc]FASTAAdd to basket
Also known as: 2alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: Missing.
     1068-1068: A → DDAHLVTLKQELEVAGNFRHRSPSRSLSVPNRPRPPHPPQRPPPPT
     1192-1434: PMLPEENFEP...NKDKRTTLGV → VYSGISQCLR...FQDLWLKFRR

Show »
Length:1,216
Mass (Da):136,363
Checksum:i8093BE1D6419C728
GO

Sequence cautioni

The sequence AAC33137 differs from that shown. Sequencing errors.Curated
The sequence AAC33137 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence BAC97932 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti571S → Y in BAB31837 (PubMed:16141072).Curated1
Sequence conflicti1013 – 1019DVLEEDE → MFLKRMK in AAC40144 (PubMed:9636665).Curated7

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti263G → R.1 Publication1
Natural varianti278E → G.1 Publication1
Natural varianti304L → P.1 Publication1
Isoform 2 (identifier: Q9D2G5-2)
Natural varianti94N → D.1
Natural varianti385S → F.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0093061 – 316Missing in isoform 3. 1 PublicationAdd BLAST316
Alternative sequenceiVSP_0093051 – 161Missing in isoform 4. 1 PublicationAdd BLAST161
Alternative sequenceiVSP_0093041 – 85Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST85
Alternative sequenceiVSP_010563162W → M in isoform 4. 1 Publication1
Alternative sequenceiVSP_009307317 – 318FK → MQ in isoform 3. 1 Publication2
Alternative sequenceiVSP_0093081068A → DDAHLVTLKQELEVAGNFRH RSPSRSLSVPNRPRPPHPPQ RPPPPT in isoform 6. 1 Publication1
Alternative sequenceiVSP_0093091106 – 1434PKART…TTLGV → VSPLWGSQGSGQRFRPAGVV LHPKTMWISVDTRNI in isoform 3. 1 PublicationAdd BLAST329
Alternative sequenceiVSP_0093101192 – 1434PMLPE…TTLGV → VYSGISQCLREELRSAACTP HAVSAQDCGDLNNRWRMPRF SHYIHTKKWKNVSLSFQDLW LKFRR in isoform 5 and isoform 6. 1 PublicationAdd BLAST243

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041857 mRNA. Translation: AAC40141.1.
AF041858 mRNA. Translation: AAC40142.1.
AF041859 mRNA. Translation: AAC40143.1.
AF041860 mRNA. Translation: AAC40144.1.
AF041861 mRNA. Translation: AAC40145.1.
AF041862 mRNA. Translation: AAC40146.1.
AK129122 mRNA. Translation: BAC97932.1. Different initiation.
AK019694 mRNA. Translation: BAB31837.1.
BC058749 mRNA. Translation: AAH58749.1.
BC060214 mRNA. Translation: AAH60214.1.
AF026123 mRNA. Translation: AAC33137.1. Sequence problems.
CCDSiCCDS28365.1. [Q9D2G5-6]
CCDS49932.1. [Q9D2G5-1]
PIRiJW0105.
PW0050.
PW0051.
RefSeqiNP_001106822.1. NM_001113351.1.
NP_001106823.1. NM_001113352.2. [Q9D2G5-1]
NP_001106824.1. NM_001113353.2.
NP_001277627.1. NM_001290698.1.
NP_035653.2. NM_011523.2. [Q9D2G5-6]
XP_006523268.1. XM_006523205.3. [Q9D2G5-5]
UniGeneiMm.236068.

Genome annotation databases

EnsembliENSMUST00000061091; ENSMUSP00000060382; ENSMUSG00000023805. [Q9D2G5-6]
ENSMUST00000080283; ENSMUSP00000079164; ENSMUSG00000023805. [Q9D2G5-1]
ENSMUST00000115784; ENSMUSP00000111450; ENSMUSG00000023805. [Q9D2G5-3]
ENSMUST00000115789; ENSMUSP00000111455; ENSMUSG00000023805. [Q9D2G5-4]
GeneIDi20975.
KEGGimmu:20975.
UCSCiuc008afm.3. mouse. [Q9D2G5-1]
uc008afp.2. mouse. [Q9D2G5-6]
uc008afu.1. mouse. [Q9D2G5-3]
uc012ajh.1. mouse. [Q9D2G5-5]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041857 mRNA. Translation: AAC40141.1.
AF041858 mRNA. Translation: AAC40142.1.
AF041859 mRNA. Translation: AAC40143.1.
AF041860 mRNA. Translation: AAC40144.1.
AF041861 mRNA. Translation: AAC40145.1.
AF041862 mRNA. Translation: AAC40146.1.
AK129122 mRNA. Translation: BAC97932.1. Different initiation.
AK019694 mRNA. Translation: BAB31837.1.
BC058749 mRNA. Translation: AAH58749.1.
BC060214 mRNA. Translation: AAH60214.1.
AF026123 mRNA. Translation: AAC33137.1. Sequence problems.
CCDSiCCDS28365.1. [Q9D2G5-6]
CCDS49932.1. [Q9D2G5-1]
PIRiJW0105.
PW0050.
PW0051.
RefSeqiNP_001106822.1. NM_001113351.1.
NP_001106823.1. NM_001113352.2. [Q9D2G5-1]
NP_001106824.1. NM_001113353.2.
NP_001277627.1. NM_001290698.1.
NP_035653.2. NM_011523.2. [Q9D2G5-6]
XP_006523268.1. XM_006523205.3. [Q9D2G5-5]
UniGeneiMm.236068.

3D structure databases

ProteinModelPortaliQ9D2G5.
SMRiQ9D2G5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9D2G5. 1 interactor.
STRINGi10090.ENSMUSP00000111457.

PTM databases

iPTMnetiQ9D2G5.
PhosphoSitePlusiQ9D2G5.

Proteomic databases

PaxDbiQ9D2G5.
PeptideAtlasiQ9D2G5.
PRIDEiQ9D2G5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000061091; ENSMUSP00000060382; ENSMUSG00000023805. [Q9D2G5-6]
ENSMUST00000080283; ENSMUSP00000079164; ENSMUSG00000023805. [Q9D2G5-1]
ENSMUST00000115784; ENSMUSP00000111450; ENSMUSG00000023805. [Q9D2G5-3]
ENSMUST00000115789; ENSMUSP00000111455; ENSMUSG00000023805. [Q9D2G5-4]
GeneIDi20975.
KEGGimmu:20975.
UCSCiuc008afm.3. mouse. [Q9D2G5-1]
uc008afp.2. mouse. [Q9D2G5-6]
uc008afu.1. mouse. [Q9D2G5-3]
uc012ajh.1. mouse. [Q9D2G5-5]

Organism-specific databases

CTDi8871.
MGIiMGI:1201671. Synj2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0566. Eukaryota.
COG5329. LUCA.
COG5411. LUCA.
GeneTreeiENSGT00760000119075.
HOVERGENiHBG079225.
InParanoidiQ9D2G5.
KOiK20279.
PhylomeDBiQ9D2G5.
TreeFamiTF354311.

Enzyme and pathway databases

ReactomeiR-MMU-1660499. Synthesis of PIPs at the plasma membrane.
R-MMU-8856828. Clathrin-mediated endocytosis.

Miscellaneous databases

ChiTaRSiSynj2. mouse.
PROiQ9D2G5.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000023805.
CleanExiMM_SYNJ2.
ExpressionAtlasiQ9D2G5. baseline and differential.
GenevisibleiQ9D2G5. MM.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
3.60.10.10. 1 hit.
InterProiIPR015047. DUF1866.
IPR005135. Endo/exonuclease/phosphatase.
IPR000300. IPPc.
IPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
IPR002013. SAC_dom.
[Graphical view]
PfamiPF08952. DUF1866. 1 hit.
PF03372. Exo_endo_phos. 1 hit.
PF02383. Syja_N. 1 hit.
[Graphical view]
SMARTiSM01165. DUF1866. 1 hit.
SM00128. IPPc. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
SSF56219. SSF56219. 2 hits.
PROSITEiPS50102. RRM. 1 hit.
PS50275. SAC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSYNJ2_MOUSE
AccessioniPrimary (citable) accession number: Q9D2G5
Secondary accession number(s): O35404
, O88399, O88400, O88401, O88402, O88403, O88404
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: January 16, 2004
Last modified: November 30, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.