Reviewed,
UniProtKB/Swiss-Prot Q9D2G5 (SYNJ2_MOUSE)
Last modified
November 3, 2009.
Version 76.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Synaptojanin-2 EC=3.1.3.36 Alternative name(s): Synaptic inositol-1,4,5-trisphosphate 5-phosphatase 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1434 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Inositol 5-phosphatase which may be involved in distinct membrane trafficking and signal transduction pathways. May mediate the inhibitory effect of Rac1 on endocytosis By similarity. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 4-phosphate + phosphate. |
| Subunit structure | Binds GRB2 and OMP25 By similarity. |
| Subcellular location | Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. |
| Tissue specificity | Ubiquitously expressed, with the highest levels in heart and brain. Detected in cortex, cerebellum and olfactory bulb. Expressed in the testis. Ref.5 Ref.6 |
| Domain | The C-terminal proline-rich region mediates binding to the SH3 domain-containing protein GRB2. |
| Sequence similarities | Belongs to the synaptojanin family. In the central section; belongs to the inositol-1,4,5-trisphosphate 5-phosphatase family. Contains 1 RRM (RNA recognition motif) domain. Contains 1 SAC domain. |
| Sequence caution | The sequence AAC33137.1 differs from that shown. Reason: Frameshift at several positions. The sequence AAC33137.1 differs from that shown. Reason: Miscellaneous discrepancy. Sequencing errors. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | RNA-binding |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | dephosphorylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell extrinsic to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity Ref.5Inferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: Q9D2G5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q9D2G5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-85: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Natural variant | 94 | 1 | N → D | ||||||
| Natural variant | 385 | 1 | S → F | ||||||
| Isoform 3 (identifier: Q9D2G5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-316: Missing. 317-318: FK → MQ 1106-1434: PKARTGISKP...NKDKRTTLGV → VSPLWGSQGSGQRFRPAGVVLHPKTMWISVDTRNI | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 4 (identifier: Q9D2G5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-161: Missing. 162-162: W → M | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 5 (identifier: Q9D2G5-5) The sequence of this isoform differs from the canonical sequence as follows: 1192-1434: PMLPEENFEP...NKDKRTTLGV → VYSGISQCLR...FQDLWLKFRR | |||||||||
| Isoform 6 (identifier: Q9D2G5-6) Also known as: 2alpha; The sequence of this isoform differs from the canonical sequence as follows: 1-85: Missing. 1068-1068: A → DDAHLVTLKQELEVAGNFRHRSPSRSLSVPNRPRPPHPPQRPPPPT 1192-1434: PMLPEENFEP...NKDKRTTLGV → VYSGISQCLR...FQDLWLKFRR | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1434 | 1434 | Synaptojanin-2 | PRO_0000209734 | |||||
Regions | |||||||||
| Domain | 120 – 444 | 325 | SAC | ||||||
| Domain | 889 – 968 | 80 | RRM | ||||||
| Region | 450 – ? | Catalytic By similarity | |||||||
| Compositional bias | 1144 – 1281 | 138 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 130 | 1 | Phosphotyrosine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 316 | 316 | Missing in isoform 3. | VSP_009306 | |||||
| Alternative sequence | 1 – 161 | 161 | Missing in isoform 4. | VSP_009305 | |||||
| Alternative sequence | 1 – 85 | 85 | Missing in isoform 2 and isoform 6. | VSP_009304 | |||||
| Alternative sequence | 162 | 1 | W → M in isoform 4. | VSP_010563 | |||||
| Alternative sequence | 317 – 318 | 2 | FK → MQ in isoform 3. | VSP_009307 | |||||
| Alternative sequence | 1068 | 1 | A → DDAHLVTLKQELEVAGNFRH RSPSRSLSVPNRPRPPHPPQ RPPPPT in isoform 6. | VSP_009308 | |||||
| Alternative sequence | 1106 – 1434 | 329 | PKART…TTLGV → VSPLWGSQGSGQRFRPAGVV LHPKTMWISVDTRNI in isoform 3. | VSP_009309 | |||||
| Alternative sequence | 1192 – 1434 | 243 | PMLPE…TTLGV → VYSGISQCLREELRSAACTP HAVSAQDCGDLNNRWRMPRF SHYIHTKKWKNVSLSFQDLW LKFRR in isoform 5 and isoform 6. | VSP_009310 | |||||
| Natural variant | 263 | 1 | G → R | ||||||
| Natural variant | 278 | 1 | E → G | ||||||
| Natural variant | 304 | 1 | L → P | ||||||
Experimental info | |||||||||
| Sequence conflict | 571 | 1 | S → Y in BAB31837. Ref.3 | ||||||
| Sequence conflict | 1013 – 1019 | 7 | DVLEEDE → MFLKRMK in AAC40144. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning of multiple isoforms of synaptojanin 2 and assignment of the gene to mouse chromosome 17A2-3.1." Seet L.-F., Cho S., Hessel A., Dumont D.J. Biochem. Biophys. Res. Commun. 247:116-122(1998) [PubMed: 9636665] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 5 AND 6), VARIANTS ARG-263; GLY-278 AND PRO-304, ALTERNATIVE SPLICING. Tissue: Brain, Embryo, Endothelial cell and Liver. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H. DNA Res. 10:167-180(2003) [PubMed: 14621295] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Embryonic tail. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J. Tissue: Testis. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Olfactory epithelium. |
| [5] | "Developmentally regulated alternative splicing in a novel synaptojanin." Khvotchev M., Suedhof T.C. J. Biol. Chem. 273:2306-2311(1998) [PubMed: 9442075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 43-1231, FUNCTION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Strain: C57BL/6J. Tissue: Brain. |
| [6] | "Mutations in Serac1 or Synj2 cause proximal t haplotype-mediated male mouse sterility but not transmission ratio distortion." Schimenti J.C., Reynolds J.L., Planchart A. Proc. Natl. Acad. Sci. U.S.A. 102:3342-3347(2005) [PubMed: 15722415] [Abstract] Cited for: TISSUE SPECIFICITY, POLYMORPHISM. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF041857 mRNA. Translation: AAC40141.1. AF041858 mRNA. Translation: AAC40142.1. AF041859 mRNA. Translation: AAC40143.1. AF041860 mRNA. Translation: AAC40144.1. AF041861 mRNA. Translation: AAC40145.1. AF041862 mRNA. Translation: AAC40146.1. AK129122 mRNA. Translation: BAC97932.1. Different initiation. AK019694 mRNA. Translation: BAB31837.1. BC058749 mRNA. Translation: AAH58749.1. BC060214 mRNA. Translation: AAH60214.1. AF026123 mRNA. Translation: AAC33137.1. Sequence problems. | |
| IPI | IPI00314785. IPI00399624. IPI00399625. IPI00399626. IPI00403713. IPI00404858. |
| PIR | JW0105. PW0050. PW0051. |
| RefSeq | NP_001106822.1. NP_001106823.1. NP_001106824.1. NP_035653.2. |
| UniGene | Mm.236068 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1I9Z based on UniProtKB O43001. |
| SMR | Q9D2G5. Positions 885-963. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9D2G5. |
PTM databases | |
| PhosphoSite | Q9D2G5. |
Proteomic databases | |
| PRIDE | Q9D2G5. |
Genome annotation databases | |
| Ensembl | ENSMUST00000061091; ENSMUSP00000060382; ENSMUSG00000023805; Mus musculus. [Genome view] ENSMUST00000080283; ENSMUSP00000079164; ENSMUSG00000023805; Mus musculus. [Genome view] ENSMUST00000115791; ENSMUSP00000111457; ENSMUSG00000023805; Mus musculus. [Genome view] |
| GeneID | 20975. |
| KEGG | mmu:20975. |
| UCSC | uc008afk.1. mouse. uc008afo.1. mouse. uc008afp.1. mouse. uc008afr.1. mouse. uc008afu.1. mouse. |
Organism-specific databases | |
| CTD | 20975. |
| MGI | MGI:1201671. Synj2. |
| Rouge | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9D2G5. |
| OMA | TVYASHK. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.36. 244. |
Gene expression databases | |
| ArrayExpress | Q9D2G5. |
| Bgee | Q9D2G5. |
| CleanEx | MM_SYNJ2. |
| Genevestigator | Q9D2G5. |
| GermOnline | ENSMUSG00000023805. Mus musculus. |
Family and domain databases | |
| InterPro | IPR015047. DUF1866. IPR005135. Endo/exonuclease/phosphatase. IPR000300. IPPc. IPR000504. RRM_RNP1. IPR002013. Syja_N. [Graphical view] |
| Pfam | PF08952. DUF1866. 1 hit. PF03372. Exo_endo_phos. 1 hit. PF02383. Syja_N. 1 hit. [Graphical view] |
| SMART | SM00128. IPPc. 1 hit. [Graphical view] |
| PROSITE | PS50102. RRM. 1 hit. PS50275. SAC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 299956. |
| SOURCE | Search... |
Entry information
| Entry name | SYNJ2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9D2G5 Secondary accession number(s): O35404 O88404 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


