Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 2-interacting protein

Gene

Cinp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, DNA damage, DNA repair, DNA replication

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 2-interacting protein
Gene namesi
Name:Cinp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1914486. Cinp.

Subcellular locationi

  • Nucleus By similarity

  • Note: Binds to nuclear under G1 conditions, and dissociates from chromatin with the start of DNA replication.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003260561 – 212Cyclin-dependent kinase 2-interacting proteinAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei69PhosphoserineBy similarity1
Modified residuei73PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by CDC7 but not by CDK2.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9D0V8.
PRIDEiQ9D0V8.

PTM databases

PhosphoSitePlusiQ9D0V8.

Expressioni

Gene expression databases

BgeeiENSMUSG00000021276.
CleanExiMM_2810452K22RIK.
GenevisibleiQ9D0V8. MM.

Interactioni

Subunit structurei

Homodimer. Interacts with CDK2 and CDC7. Interacts with the components of the replication complex, MCM2, MCM3, MCM4, MCM5, MCM6, MCM7 and with ORC2-containing complexes (By similarity). Interacts with ATRIP (By similarity). Interacts with CEP152 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035245.

Structurei

3D structure databases

ProteinModelPortaliQ9D0V8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili73 – 107Sequence analysisAdd BLAST35

Sequence similaritiesi

Belongs to the CINP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IWVU. Eukaryota.
ENOG4111M0E. LUCA.
GeneTreeiENSGT00390000015784.
HOGENOMiHOG000035137.
HOVERGENiHBG061504.
InParanoidiQ9D0V8.
OMAiNYHYGEE.
OrthoDBiEOG091G0RIF.
PhylomeDBiQ9D0V8.
TreeFamiTF329462.

Family and domain databases

InterProiIPR023250. Cyclin-dep_Kinase_2_interact.
[Graphical view]
PRINTSiPR02040. CDK2IP.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9D0V8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAKTLGIAT PRKPVLSVSA RKLKDNAADW HNLILKWDSL SDKGFTTASS
60 70 80 90 100
IANLKVSLLS KEKVELESSS PASMEEEEKT NLDYDKGLEA LCEELQAILD
110 120 130 140 150
GLTKIQMKME KLSSTTKGIC ELENYHYREE SSRPPLFHTW PTAFFYEVSR
160 170 180 190 200
RLSEAYKKEL LLKHTIGAEL AHTADRNLSL TYLSMWLHQP YIESNSKLQL
210
ESMLLETGHR AL
Length:212
Mass (Da):24,104
Last modified:June 1, 2001 - v1
Checksum:iC9977FD22DBE8AF9
GO
Isoform 2 (identifier: Q9D0V8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-117: TKIQMKMEKLSSTTK → GIQHPVLVCTAPTHK
     118-212: Missing.

Note: No experimental confirmation available.
Show »
Length:117
Mass (Da):12,760
Checksum:iBC4D73EAF18A48A0
GO
Isoform 3 (identifier: Q9D0V8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-137: LTKIQMKMEKLSSTTKGICELENYHYREESSRPPLF → MVRPKDAGHRHHCLGLLTVGAFRTVGGLSFHLPNKS
     138-212: Missing.

Note: No experimental confirmation available.
Show »
Length:137
Mass (Da):14,956
Checksum:iD642244E60C88571
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032527102 – 137LTKIQ…RPPLF → MVRPKDAGHRHHCLGLLTVG AFRTVGGLSFHLPNKS in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032525103 – 117TKIQM…SSTTK → GIQHPVLVCTAPTHK in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_032526118 – 212Missing in isoform 2. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_032528138 – 212Missing in isoform 3. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004355 mRNA. Translation: BAB23273.1.
AK007812 mRNA. Translation: BAB25277.1.
AK076126 mRNA. Translation: BAC36203.1.
AK032155 mRNA. Translation: BAC27729.1.
BC011066 mRNA. Translation: AAH11066.1.
CCDSiCCDS36561.1. [Q9D0V8-1]
RefSeqiNP_080324.1. NM_026048.4. [Q9D0V8-1]
UniGeneiMm.287157.

Genome annotation databases

EnsembliENSMUST00000043716; ENSMUSP00000035245; ENSMUSG00000021276. [Q9D0V8-1]
GeneIDi67236.
KEGGimmu:67236.
UCSCiuc007pcb.2. mouse. [Q9D0V8-1]
uc007pcd.2. mouse. [Q9D0V8-2]
uc007pce.2. mouse. [Q9D0V8-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004355 mRNA. Translation: BAB23273.1.
AK007812 mRNA. Translation: BAB25277.1.
AK076126 mRNA. Translation: BAC36203.1.
AK032155 mRNA. Translation: BAC27729.1.
BC011066 mRNA. Translation: AAH11066.1.
CCDSiCCDS36561.1. [Q9D0V8-1]
RefSeqiNP_080324.1. NM_026048.4. [Q9D0V8-1]
UniGeneiMm.287157.

3D structure databases

ProteinModelPortaliQ9D0V8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035245.

PTM databases

PhosphoSitePlusiQ9D0V8.

Proteomic databases

PaxDbiQ9D0V8.
PRIDEiQ9D0V8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000043716; ENSMUSP00000035245; ENSMUSG00000021276. [Q9D0V8-1]
GeneIDi67236.
KEGGimmu:67236.
UCSCiuc007pcb.2. mouse. [Q9D0V8-1]
uc007pcd.2. mouse. [Q9D0V8-2]
uc007pce.2. mouse. [Q9D0V8-3]

Organism-specific databases

CTDi51550.
MGIiMGI:1914486. Cinp.

Phylogenomic databases

eggNOGiENOG410IWVU. Eukaryota.
ENOG4111M0E. LUCA.
GeneTreeiENSGT00390000015784.
HOGENOMiHOG000035137.
HOVERGENiHBG061504.
InParanoidiQ9D0V8.
OMAiNYHYGEE.
OrthoDBiEOG091G0RIF.
PhylomeDBiQ9D0V8.
TreeFamiTF329462.

Miscellaneous databases

PROiQ9D0V8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021276.
CleanExiMM_2810452K22RIK.
GenevisibleiQ9D0V8. MM.

Family and domain databases

InterProiIPR023250. Cyclin-dep_Kinase_2_interact.
[Graphical view]
PRINTSiPR02040. CDK2IP.
ProtoNetiSearch...

Entry informationi

Entry nameiCINP_MOUSE
AccessioniPrimary (citable) accession number: Q9D0V8
Secondary accession number(s): Q8C063, Q9D8P9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.