Q9D020 (5NT3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic 5'-nucleotidase 3 EC=3.1.3.5 Alternative name(s): Cytosolic 5'-nucleotidase III Short name=cN-III Lupin Pyrimidine 5'-nucleotidase 1 Short name=P5'N-1 Short name=P5N-1 Short name=PN-I | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 331 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Can act both as nucleotidase and as phosphotransferase By similarity. |
| Catalytic activity | A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate. |
| Subunit structure | Monomer. |
| Subcellular location | Cytoplasm Potential. |
| Tissue specificity | Isoform 2 is highly expressed in the brain, heart, spleen, kidney and blood. Isoform 2 is expressed (at protein level) in the spleen, skeletal muscle and gastrointestinal epithelia. |
| Developmental stage | Isoform 2 is weakly expressed from E7.5 and the expression level steadily increased through gestation. At E9.5 and E10.5 is first detected colocalizing with embryonic blood cells within the region of the septum transversum and within the cardiac chambers and dorsal aorta. At E12.5 expression is found in the ventral neural tube and in the trigeminal ganglia and in the liver and dorsal root ganglia. Expression persisted in the liver, dorsal root and trigeminal ganglia at E13.5 and weaker expression becomes apparent in cardiac and skeletal muscle. At E16.5 expression is detected in liver, myocardium, tongue, bronchial epithelium, gastrointestinal epithelium, cartilage and forebrain neuroepithelium. |
| Sequence similarities | Belongs to the pyrimidine 5'-nucleotidase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Nucleotide metabolism |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase Transferase |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological process | nucleotide metabolic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | endoplasmic reticulum Inferred from sequence or structural similarity. Source: UniProtKB mitochondrionInferred from direct assay. Source: MGI |
| Molecular function | 5'-nucleotidase activity Inferred from sequence or structural similarity. Source: UniProtKB magnesium ion bindingInferred from electronic annotation. Source: InterPro nucleotide bindingInferred from electronic annotation. Source: UniProtKB-KW transferase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q9D020-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9D020-1) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MDRAAVARVGAVASASVCAVVAGVVLAQYIFTLKRKTGRKTKIIE → MTNQESAVHLK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 331 | 331 | Cytosolic 5'-nucleotidase 3 | PRO_0000064388 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 198 – 200 | 3 | Substrate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 83 | 1 | Nucleophile | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 85 | 1 | Proton donor | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 83 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 85 | 1 | Magnesium; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 272 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 247 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 45 | 45 | MDRAA…TKIIE → MTNQESAVHLK in isoform 1. | VSP_021566 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 183 | 1 | F → L in BAB27677. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 260 | 1 | Q → R in BAB27901. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 48 – 51 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 60 – 73 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 75 – 77 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 78 – 82 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 85 – 87 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 93 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 101 – 106 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 113 – 130 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 133 – 135 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 137 – 158 | 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 164 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 165 – 171 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 190 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 201 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 211 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 219 – 224 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 226 – 228 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 232 – 237 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 247 – 252 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 255 – 260 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 261 – 263 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 274 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 275 – 278 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 279 – 282 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 287 – 295 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 299 – 309 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 315 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 321 – 330 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and expression analysis of murine lupin, a member of a novel gene family that is conserved through evolution and associated with Lupus inclusions." Lu M.M., Chen F., Gitler A., Li J., Jin F., Ma X.K., Epstein J.A. Dev. Genes Evol. 210:512-517(2000) [PubMed: 11180800] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Embryo. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: Czech II. Tissue: Mammary gland. |
| [4] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 118-123, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [5] | "Structure of pyrimidine 5'-nucleotidase type 1. Insight into mechanism of action and inhibition during lead poisoning." Bitto E., Bingman C.A., Wesenberg G.E., McCoy J.G., Phillips G.N. Jr. J. Biol. Chem. 281:20521-20529(2006) [PubMed: 16672222] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) (ISOFORM 1) IN COMPLEXES WITH MAGNESIUM; PHOSPHATE; TRANSITION STATE ANALOG AND LEAD IONS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK011525 mRNA. Translation: BAB27677.2. AK011894 mRNA. Translation: BAB27901.2. BC038029 mRNA. Translation: AAH38029.1. | ||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00187512. IPI00648235. | ||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001239303.1. NM_001252374.1. NP_080280.3. NM_026004.3. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Mm.158936. | ||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q9D020. Positions 44-331. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSMUST00000031793; ENSMUSP00000031793; ENSMUSG00000029780. ENSMUST00000101367; ENSMUSP00000098918; ENSMUSG00000029780. ENSMUST00000116607; ENSMUSP00000112306; ENSMUSG00000029780. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 107569. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | mmu:107569. | ||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc009cbq.2. mouse. uc009cbr.2. mouse. | ||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 51251. | ||||||||||||||||||||||||||||||||||||||||||||||||
| MGI | MGI:1927186. Nt5c3. | ||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | roNOG11964. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000012959. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HBG382723. | ||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG059750. | ||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | NTEYFKQ. | ||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4JWVDW. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | MM_NT5C3. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9D020. | ||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSMUSG00000029780. Mus musculus. | ||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR023214. HAD-like_dom. IPR006383. HAD-SF_hydro_IB_PSP-like. IPR006434. Pyrimidine_nucleotidase_eu. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.40.50.1000. HAD-like_dom. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K01081. | ||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR13045. HAD-SF_hydro_IE. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF05822. UMPH-1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF56784. HAD-like_dom. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR01488. HAD-SF-IB. 1 hit. TIGR01544. HAD-SF-IE. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 359058. | ||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | 5NT3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9D020 Secondary accession number(s): Q8CI05, Q9D0D9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with