true2008-04-292024-03-27133SSU72_MOUSEThe transcriptional landscape of the mammalian genome.Carninci P.Kasukawa T.Katayama S.Gough J.Frith M.C.Maeda N.Oyama R.Ravasi T.Lenhard B.Wells C.Kodzius R.Shimokawa K.Bajic V.B.Brenner S.E.Batalov S.Forrest A.R.Zavolan M.Davis M.J.Wilming L.G.Aidinis V.Allen J.E.Ambesi-Impiombato A.Apweiler R.Aturaliya R.N.Bailey T.L.Bansal M.Baxter L.Beisel K.W.Bersano T.Bono H.Chalk A.M.Chiu K.P.Choudhary V.Christoffels A.Clutterbuck D.R.Crowe M.L.Dalla E.Dalrymple B.P.de Bono B.Della Gatta G.di Bernardo D.Down T.Engstrom P.Fagiolini M.Faulkner G.Fletcher C.F.Fukushima T.Furuno M.Futaki S.Gariboldi M.Georgii-Hemming P.Gingeras T.R.Gojobori T.Green R.E.Gustincich S.Harbers M.Hayashi Y.Hensch T.K.Hirokawa N.Hill D.Huminiecki L.Iacono M.Ikeo K.Iwama A.Ishikawa T.Jakt M.Kanapin A.Katoh M.Kawasawa Y.Kelso J.Kitamura H.Kitano H.Kollias G.Krishnan S.P.Kruger A.Kummerfeld S.K.Kurochkin I.V.Lareau L.F.Lazarevic D.Lipovich L.Liu J.Liuni S.McWilliam S.Madan Babu M.Madera M.Marchionni L.Matsuda H.Matsuzawa S.Miki H.Mignone F.Miyake S.Morris K.Mottagui-Tabar S.Mulder N.Nakano N.Nakauchi H.Ng P.Nilsson R.Nishiguchi S.Nishikawa S.Nori F.Ohara O.Okazaki Y.Orlando V.Pang K.C.Pavan W.J.Pavesi G.Pesole G.Petrovsky N.Piazza S.Reed J.Reid J.F.Ring B.Z.Ringwald M.Rost B.Ruan Y.Salzberg S.L.Sandelin A.Schneider C.Schoenbach C.Sekiguchi K.Semple C.A.Seno S.Sessa L.Sheng Y.Shibata Y.Shimada H.Shimada K.Silva D.Sinclair B.Sperling S.Stupka E.Sugiura K.Sultana R.Takenaka Y.Taki K.Tammoja K.Tan S.L.Tang S.Taylor M.S.Tegner J.Teichmann S.A.Ueda H.R.van Nimwegen E.Verardo R.Wei C.L.Yagi K.Yamanishi H.Zabarovsky E.Zhu S.Zimmer A.Hide W.Bult C.Grimmond S.M.Teasdale R.D.Liu E.T.Brusic V.Quackenbush J.Wahlestedt C.Mattick J.S.Hume D.A.Kai C.Sasaki D.Tomaru Y.Fukuda S.Kanamori-Katayama M.Suzuki M.Aoki J.Arakawa T.Iida J.Imamura K.Itoh M.Kato T.Kawaji H.Kawagashira N.Kawashima T.Kojima M.Kondo S.Konno H.Nakano K.Ninomiya N.Nishio T.Okada M.Plessy C.Shibata K.Shiraki T.Suzuki S.Tagami M.Waki K.Watahiki A.Okamura-Oho Y.Suzuki H.Kawai J.Hayashizaki Y.doi:10.1126/science.11120142005Science3091559-1563NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1)C57BL/6JCerebellumEmbryoSympathetic ganglionLineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M.Goodstadt L.Hillier L.W.Zody M.C.Goldstein S.She X.Bult C.J.Agarwala R.Cherry J.L.DiCuccio M.Hlavina W.Kapustin Y.Meric P.Maglott D.Birtle Z.Marques A.C.Graves T.Zhou S.Teague B.Potamousis K.Churas C.Place M.Herschleb J.Runnheim R.Forrest D.Amos-Landgraf J.Schwartz D.C.Cheng Z.Lindblad-Toh K.Eichler E.E.Ponting C.P.doi:10.1371/journal.pbio.10001122009PLoS Biol.7E1000112NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Teamdoi:10.1101/gr.25965042004Genome Res.142121-2127NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2)FVB/NMammary tumorConserved and specific functions of mammalian ssu72.St Pierre B.Liu X.Kha L.C.Zhu X.Ryan O.Jiang Z.Zacksenhaus E.doi:10.1093/nar/gki1712005Nucleic Acids Res.33464-477FUNCTIONTISSUE SPECIFICITYDEVELOPMENTAL STAGEA tissue-specific atlas of mouse protein phosphorylation and expression.Huttlin E.L.Jedrychowski M.P.Elias J.E.Goswami T.Rad R.Beausoleil S.A.Villen J.Haas W.Sowa M.E.Gygi S.P.doi:10.1016/j.cell.2010.12.0012010Cell1431174-1189IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]BrainBrown adipose tissueKidneyLiverLungSpleenTestis148 antibodies from 21 providersmousemouseSsu72EukaryotaRNA polymerase II transcribes snRNA genes31 hits in 78 CRISPR screensmouseProteinExpressed in granulocyte and 269 other cell types or tissuesRNA_pol_II_suARNA POLYMERASE II SUBUNIT A C-TERMINAL DOMAIN PHOSPHATASERNA POLYMERASE II SUBUNIT A C-TERMINAL DOMAIN PHOSPHATASE SSU72Ssu72MMRNA polymerase II subunit A C-terminal domain phosphatase SSU72CTD phosphatase SSU723.1.3.16Ssu72Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.Interacts with GTF2B (via C-terminus); this interaction is inhibited by SYMPK. Interacts with RB1. Interacts with CD226. Interacts with SYMPK.Predominantly in the cytosol.Highly expressed in the brain. Expressed at low level in most tissues.At 10.5 dpc, low level expression detected throughout the embryo with relative accumulation in spinal cord and brain folds. At 13.5 dpc, highly expressed in the CNS both in the ventricular (mitotic) and marginal (post mitotic) zones, in the PNS in dorsal root and trigeminal ganglia, and the developing gut. During development, expression in the central nervous system and peripheral nervous system persists, and expression in the intestine is further induced. Expression in the intestine is observed throughout the mucosal villi, which contains epithelial cells and other cell types. High expression is also detected in the lens. No expression is seen in other tissues such as liver, lung, bone, cardiac and skeletal muscles.Belongs to the SSU72 phosphatase family.RNA polymerase II subunit A C-terminal domain phosphatase SSU72225171194160187In isoform 2.VSLSSWVLLGLLIATYKNKIK162P592001-06-011225176c95e1b6895561ab76b91e774ffbdd051MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRAFLHTVCFY2MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCVSLSSWVLLGLLIATYKNKIKtruetruetruetruetruetruetruetruetrue