Q9CY97 (SSU72_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RNA polymerase II subunit A C-terminal domain phosphatase SSU72 Short name=CTD phosphatase SSU72 EC=3.1.3.16 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 194 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK. Ref.4 |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Interacts with RB1. Interacts with GTF2B and CD226. Interacts with SYMPK By similarity. |
| Subcellular location | Nucleus By similarity. Cytoplasm By similarity. Note: Predominantly in the cytosol By similarity. |
| Tissue specificity | Highly expressed in the brain. Expressed at low level in most tissues. Ref.4 |
| Developmental stage | At E10.5, low level expression detected throughout the embryo with relative accumulation in spinal cord and brain folds. At E13.5, highly expressed in the CNS both in the ventricular (mitotic) and marginal (post mitotic) zones, in the PNS in dorsal root and trigeminal ganglia, and the developing gut. During development, expression in the central nervous system and peripheral nervous system persists, and expression in the intestine is further induced. Expression in the intestine is observed throughout the mucosal villi, which contains epithelial cells and other cell types. High expression is also detected in the lens. No expression is seen in other tissues such as liver, lung, bone, cardiac and skeletal muscles. Ref.4 |
| Sequence similarities | Belongs to the SSU72 phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | mRNA processing |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | dephosphorylation of RNA polymerase II C-terminal domain Inferred from sequence or structural similarity. Source: UniProtKB mRNA polyadenylationInferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | CTD phosphatase activity Inferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9CY97-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9CY97-2) The sequence of this isoform differs from the canonical sequence as follows: 162-194: IQHTEDMENEIDELLQEFEEKSGRAFLHTVCFY → VSLSSWVLLGLLIATYKNKIK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 194 | 194 | RNA polymerase II subunit A C-terminal domain phosphatase SSU72 | PRO_0000330013 | |||||
Regions | |||||||||
| Coiled coil | 160 – 187 | 28 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 162 – 194 | 33 | IQHTE…TVCFY → VSLSSWVLLGLLIATYKNKI K in isoform 2. | VSP_033006 | |||||
Experimental info | |||||||||
| Sequence conflict | 59 | 1 | T → P in BAB23890. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK005220 mRNA. Translation: BAB23890.1. AK019168 mRNA. Translation: BAB31582.1. AK148783 mRNA. Translation: BAE28662.1. AL670236 Genomic DNA. Translation: CAM18380.1. AL670236 Genomic DNA. Translation: CAM18381.1. BC016544 mRNA. Translation: AAH16544.1. |
| IPI | IPI00318564. IPI00460332. |
| RefSeq | NP_081175.2. NM_026899.3. |
| UniGene | Mm.294770. Mm.483261. |
3D structure databases | |
| ProteinModelPortal | Q9CY97. |
| SMR | Q9CY97. Positions 5-194. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000030905. |
PTM databases | |
| PhosphoSite | Q9CY97. |
Proteomic databases | |
| PaxDb | Q9CY97. |
| PRIDE | Q9CY97. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000030905; ENSMUSP00000030905; ENSMUSG00000029038. ENSMUST00000105595; ENSMUSP00000101220; ENSMUSG00000029038. |
| GeneID | 68991. |
| KEGG | mmu:68991. |
| UCSC | uc008wek.2. mouse. uc008wel.2. mouse. |
Organism-specific databases | |
| CTD | 29101. |
| MGI | MGI:1916241. Ssu72. |
Phylogenomic databases | |
| eggNOG | COG5211. |
| GeneTree | ENSGT00390000010165. |
| HOGENOM | HOG000183445. |
| HOVERGEN | HBG059831. |
| InParanoid | Q9CY97. |
| KO | K15544. |
| OMA | SMEAHNF. |
| OrthoDB | EOG49PB0D. |
Gene expression databases | |
| Bgee | Q9CY97. |
| Genevestigator | Q9CY97. |
Family and domain databases | |
| InterPro | IPR006811. RNA_pol_II_suA. [Graphical view] |
| PANTHER | PTHR20383. PTHR20383. 1 hit. |
| Pfam | PF04722. Ssu72. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 328359. |
| SOURCE | Search... |
Entry information
| Entry name | SSU72_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9CY97 Secondary accession number(s): Q3UF99, Q91YL1, Q9DB51 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
