Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9CY97

- SSU72_MOUSE

UniProt

Q9CY97 - SSU72_MOUSE

Protein

RNA polymerase II subunit A C-terminal domain phosphatase SSU72

Gene

Ssu72

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.1 Publication

    Catalytic activityi

    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    GO - Molecular functioni

    1. CTD phosphatase activity Source: UniProtKB

    GO - Biological processi

    1. dephosphorylation of RNA polymerase II C-terminal domain Source: UniProtKB
    2. mRNA polyadenylation Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Biological processi

    mRNA processing

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RNA polymerase II subunit A C-terminal domain phosphatase SSU72 (EC:3.1.3.16)
    Short name:
    CTD phosphatase SSU72
    Gene namesi
    Name:Ssu72
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:1916241. Ssu72.

    Subcellular locationi

    Nucleus By similarity. Cytoplasm By similarity
    Note: Predominantly in the cytosol.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 194194RNA polymerase II subunit A C-terminal domain phosphatase SSU72PRO_0000330013Add
    BLAST

    Proteomic databases

    MaxQBiQ9CY97.
    PaxDbiQ9CY97.
    PRIDEiQ9CY97.

    PTM databases

    PhosphoSiteiQ9CY97.

    Expressioni

    Tissue specificityi

    Highly expressed in the brain. Expressed at low level in most tissues.1 Publication

    Developmental stagei

    At E10.5, low level expression detected throughout the embryo with relative accumulation in spinal cord and brain folds. At E13.5, highly expressed in the CNS both in the ventricular (mitotic) and marginal (post mitotic) zones, in the PNS in dorsal root and trigeminal ganglia, and the developing gut. During development, expression in the central nervous system and peripheral nervous system persists, and expression in the intestine is further induced. Expression in the intestine is observed throughout the mucosal villi, which contains epithelial cells and other cell types. High expression is also detected in the lens. No expression is seen in other tissues such as liver, lung, bone, cardiac and skeletal muscles.1 Publication

    Gene expression databases

    BgeeiQ9CY97.
    GenevestigatoriQ9CY97.

    Interactioni

    Subunit structurei

    Interacts with RB1. Interacts with GTF2B and CD226. Interacts with SYMPK By similarity.By similarity

    Protein-protein interaction databases

    IntActiQ9CY97. 1 interaction.
    MINTiMINT-4125924.
    STRINGi10090.ENSMUSP00000030905.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9CY97.
    SMRiQ9CY97. Positions 5-194.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili160 – 18728Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SSU72 phosphatase family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5211.
    GeneTreeiENSGT00390000010165.
    HOGENOMiHOG000183445.
    HOVERGENiHBG059831.
    InParanoidiQ9CY97.
    KOiK15544.
    OMAiNRPFLHT.
    OrthoDBiEOG7C2R2M.
    PhylomeDBiQ9CY97.
    TreeFamiTF300194.

    Family and domain databases

    InterProiIPR006811. RNA_pol_II_suA.
    [Graphical view]
    PANTHERiPTHR20383. PTHR20383. 1 hit.
    PfamiPF04722. Ssu72. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9CY97-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPSSPLRVAV VCSSNQNRSM EAHNILSKRG FSVRSFGTGT HVKLPGPAPD    50
    KPNVYDFKTT YDQMYNDLLR KDKELYTQNG ILHMLDRNKR IKPRPERFQN 100
    CTDLFDLILT CEERVYDQVV EDLNSREQET CQPVHVVNVD IQDNHEEATL 150
    GAFLICELCQ CIQHTEDMEN EIDELLQEFE EKSGRAFLHT VCFY 194
    Length:194
    Mass (Da):22,517
    Last modified:June 1, 2001 - v1
    Checksum:i51B89AC7BCD79486
    GO
    Isoform 2 (identifier: Q9CY97-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         162-194: IQHTEDMENEIDELLQEFEEKSGRAFLHTVCFY → VSLSSWVLLGLLIATYKNKIK

    Note: No experimental confirmation available.

    Show »
    Length:182
    Mass (Da):20,862
    Checksum:i5F3F793A72405661
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti59 – 591T → P in BAB23890. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei162 – 19433IQHTE…TVCFY → VSLSSWVLLGLLIATYKNKI K in isoform 2. 1 PublicationVSP_033006Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK005220 mRNA. Translation: BAB23890.1.
    AK019168 mRNA. Translation: BAB31582.1.
    AK148783 mRNA. Translation: BAE28662.1.
    AL670236 Genomic DNA. Translation: CAM18380.1.
    AL670236 Genomic DNA. Translation: CAM18381.1.
    BC016544 mRNA. Translation: AAH16544.1.
    CCDSiCCDS19036.1. [Q9CY97-1]
    RefSeqiNP_081175.2. NM_026899.3. [Q9CY97-1]
    UniGeneiMm.294770.
    Mm.483261.

    Genome annotation databases

    EnsembliENSMUST00000030905; ENSMUSP00000030905; ENSMUSG00000029038. [Q9CY97-1]
    ENSMUST00000105595; ENSMUSP00000101220; ENSMUSG00000029038. [Q9CY97-2]
    GeneIDi68991.
    KEGGimmu:68991.
    UCSCiuc008wek.2. mouse. [Q9CY97-2]
    uc008wel.2. mouse. [Q9CY97-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK005220 mRNA. Translation: BAB23890.1 .
    AK019168 mRNA. Translation: BAB31582.1 .
    AK148783 mRNA. Translation: BAE28662.1 .
    AL670236 Genomic DNA. Translation: CAM18380.1 .
    AL670236 Genomic DNA. Translation: CAM18381.1 .
    BC016544 mRNA. Translation: AAH16544.1 .
    CCDSi CCDS19036.1. [Q9CY97-1 ]
    RefSeqi NP_081175.2. NM_026899.3. [Q9CY97-1 ]
    UniGenei Mm.294770.
    Mm.483261.

    3D structure databases

    ProteinModelPortali Q9CY97.
    SMRi Q9CY97. Positions 5-194.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9CY97. 1 interaction.
    MINTi MINT-4125924.
    STRINGi 10090.ENSMUSP00000030905.

    PTM databases

    PhosphoSitei Q9CY97.

    Proteomic databases

    MaxQBi Q9CY97.
    PaxDbi Q9CY97.
    PRIDEi Q9CY97.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000030905 ; ENSMUSP00000030905 ; ENSMUSG00000029038 . [Q9CY97-1 ]
    ENSMUST00000105595 ; ENSMUSP00000101220 ; ENSMUSG00000029038 . [Q9CY97-2 ]
    GeneIDi 68991.
    KEGGi mmu:68991.
    UCSCi uc008wek.2. mouse. [Q9CY97-2 ]
    uc008wel.2. mouse. [Q9CY97-1 ]

    Organism-specific databases

    CTDi 29101.
    MGIi MGI:1916241. Ssu72.

    Phylogenomic databases

    eggNOGi COG5211.
    GeneTreei ENSGT00390000010165.
    HOGENOMi HOG000183445.
    HOVERGENi HBG059831.
    InParanoidi Q9CY97.
    KOi K15544.
    OMAi NRPFLHT.
    OrthoDBi EOG7C2R2M.
    PhylomeDBi Q9CY97.
    TreeFami TF300194.

    Miscellaneous databases

    NextBioi 328359.
    PROi Q9CY97.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9CY97.
    Genevestigatori Q9CY97.

    Family and domain databases

    InterProi IPR006811. RNA_pol_II_suA.
    [Graphical view ]
    PANTHERi PTHR20383. PTHR20383. 1 hit.
    Pfami PF04722. Ssu72. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Cerebellum, Embryo and Sympathetic ganglion.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: FVB/N.
      Tissue: Mammary tumor.
    4. Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

    Entry informationi

    Entry nameiSSU72_MOUSE
    AccessioniPrimary (citable) accession number: Q9CY97
    Secondary accession number(s): Q3UF99, Q91YL1, Q9DB51
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 29, 2008
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 85 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3