Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9CY97 (SSU72_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 84. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
RNA polymerase II subunit A C-terminal domain phosphatase SSU72

Short name=CTD phosphatase SSU72
EC=3.1.3.16
Gene names
Name:Ssu72
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length194 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK. Ref.4

Catalytic activity

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Subunit structure

Interacts with RB1. Interacts with GTF2B and CD226. Interacts with SYMPK By similarity.

Subcellular location

Nucleus By similarity. Cytoplasm By similarity. Note: Predominantly in the cytosol By similarity.

Tissue specificity

Highly expressed in the brain. Expressed at low level in most tissues. Ref.4

Developmental stage

At E10.5, low level expression detected throughout the embryo with relative accumulation in spinal cord and brain folds. At E13.5, highly expressed in the CNS both in the ventricular (mitotic) and marginal (post mitotic) zones, in the PNS in dorsal root and trigeminal ganglia, and the developing gut. During development, expression in the central nervous system and peripheral nervous system persists, and expression in the intestine is further induced. Expression in the intestine is observed throughout the mucosal villi, which contains epithelial cells and other cell types. High expression is also detected in the lens. No expression is seen in other tissues such as liver, lung, bone, cardiac and skeletal muscles. Ref.4

Sequence similarities

Belongs to the SSU72 phosphatase family.

Ontologies

Keywords
   Biological processmRNA processing
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   Molecular functionHydrolase
Protein phosphatase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processdephosphorylation of RNA polymerase II C-terminal domain

Inferred from sequence or structural similarity. Source: UniProtKB

mRNA polyadenylation

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionCTD phosphatase activity

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9CY97-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9CY97-2)

The sequence of this isoform differs from the canonical sequence as follows:
     162-194: IQHTEDMENEIDELLQEFEEKSGRAFLHTVCFY → VSLSSWVLLGLLIATYKNKIK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 194194RNA polymerase II subunit A C-terminal domain phosphatase SSU72
PRO_0000330013

Regions

Coiled coil160 – 18728 Potential

Natural variations

Alternative sequence162 – 19433IQHTE…TVCFY → VSLSSWVLLGLLIATYKNKI K in isoform 2.
VSP_033006

Experimental info

Sequence conflict591T → P in BAB23890. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 51B89AC7BCD79486

FASTA19422,517
        10         20         30         40         50         60 
MPSSPLRVAV VCSSNQNRSM EAHNILSKRG FSVRSFGTGT HVKLPGPAPD KPNVYDFKTT 

        70         80         90        100        110        120 
YDQMYNDLLR KDKELYTQNG ILHMLDRNKR IKPRPERFQN CTDLFDLILT CEERVYDQVV 

       130        140        150        160        170        180 
EDLNSREQET CQPVHVVNVD IQDNHEEATL GAFLICELCQ CIQHTEDMEN EIDELLQEFE 

       190 
EKSGRAFLHT VCFY 

« Hide

Isoform 2 [UniParc].

Checksum: 5F3F793A72405661
Show »

FASTA18220,862

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Cerebellum, Embryo and Sympathetic ganglion.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: FVB/N.
Tissue: Mammary tumor.
[4]"Conserved and specific functions of mammalian ssu72."
St Pierre B., Liu X., Kha L.C., Zhu X., Ryan O., Jiang Z., Zacksenhaus E.
Nucleic Acids Res. 33:464-477(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK005220 mRNA. Translation: BAB23890.1.
AK019168 mRNA. Translation: BAB31582.1.
AK148783 mRNA. Translation: BAE28662.1.
AL670236 Genomic DNA. Translation: CAM18380.1.
AL670236 Genomic DNA. Translation: CAM18381.1.
BC016544 mRNA. Translation: AAH16544.1.
CCDSCCDS19036.1. [Q9CY97-1]
RefSeqNP_081175.2. NM_026899.3. [Q9CY97-1]
UniGeneMm.294770.
Mm.483261.

3D structure databases

ProteinModelPortalQ9CY97.
SMRQ9CY97. Positions 5-194.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ9CY97. 1 interaction.
MINTMINT-4125924.
STRING10090.ENSMUSP00000030905.

PTM databases

PhosphoSiteQ9CY97.

Proteomic databases

MaxQBQ9CY97.
PaxDbQ9CY97.
PRIDEQ9CY97.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000030905; ENSMUSP00000030905; ENSMUSG00000029038. [Q9CY97-1]
ENSMUST00000105595; ENSMUSP00000101220; ENSMUSG00000029038. [Q9CY97-2]
GeneID68991.
KEGGmmu:68991.
UCSCuc008wek.2. mouse. [Q9CY97-2]
uc008wel.2. mouse. [Q9CY97-1]

Organism-specific databases

CTD29101.
MGIMGI:1916241. Ssu72.

Phylogenomic databases

eggNOGCOG5211.
GeneTreeENSGT00390000010165.
HOGENOMHOG000183445.
HOVERGENHBG059831.
InParanoidQ9CY97.
KOK15544.
OMANRPFLHT.
OrthoDBEOG7C2R2M.
PhylomeDBQ9CY97.
TreeFamTF300194.

Gene expression databases

BgeeQ9CY97.
GenevestigatorQ9CY97.

Family and domain databases

InterProIPR006811. RNA_pol_II_suA.
[Graphical view]
PANTHERPTHR20383. PTHR20383. 1 hit.
PfamPF04722. Ssu72. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio328359.
PROQ9CY97.
SOURCESearch...

Entry information

Entry nameSSU72_MOUSE
AccessionPrimary (citable) accession number: Q9CY97
Secondary accession number(s): Q3UF99, Q91YL1, Q9DB51
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot