Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Apoptogenic protein 1, mitochondrial

Gene

Apopt1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the regulation of apoptosis. Mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade.2 Publications

GO - Biological processi

  • intrinsic apoptotic signaling pathway Source: MGI
  • positive regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: UniProtKB
  • positive regulation of release of cytochrome c from mitochondria Source: UniProtKB
  • positive regulation of smooth muscle cell apoptotic process Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Apoptogenic protein 1, mitochondrial
Short name:
APOP-1
Gene namesi
Name:Apopt1
Synonyms:Apop1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1915270. Apopt1.

Subcellular locationi

GO - Cellular componenti

  • mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 2626MitochondrionSequence analysisAdd
BLAST
Chaini27 – 192166Apoptogenic protein 1, mitochondrialPRO_0000353108Add
BLAST

Proteomic databases

MaxQBiQ9CQW7.
PaxDbiQ9CQW7.
PRIDEiQ9CQW7.

PTM databases

iPTMnetiQ9CQW7.
PhosphoSiteiQ9CQW7.

Expressioni

Tissue specificityi

Expressed in atherosclerotic smooth muscle cells (at protein level). Expressed in aorta, brain, heart, kidney, liver, lung and spleen. Isoform 1 is strongly expressed in Kidney. Isoform 2 is strongly expressed in brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000037787.
ExpressionAtlasiQ9CQW7. baseline and differential.
GenevisibleiQ9CQW7. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131169.

Family & Domainsi

Sequence similaritiesi

Belongs to the APOPT family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG4094. Eukaryota.
ENOG4111VRW. LUCA.
GeneTreeiENSGT00390000008212.
HOGENOMiHOG000111828.
HOVERGENiHBG074760.
InParanoidiQ9CQW7.
OMAiWIGPPNP.
OrthoDBiEOG091G0ZZ4.
PhylomeDBiQ9CQW7.
TreeFamiTF315168.

Family and domain databases

InterProiIPR018796. UPF0671.
[Graphical view]
PfamiPF10231. DUF2315. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CQW7-1) [UniParc]FASTAAdd to basket
Also known as: Apop-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALRPGSRA LRRLLCRSFS GGGGVRLARE RPTDHRDAAS SRVSRFCPPR
60 70 80 90 100
QSCHDWIGPP DKCSNLRPVH FHIPENESPL EQRLRELRQE TQEWNQQFWA
110 120 130 140 150
KQNLSFNKEK EEFIYSRLQA KGAGLRTESG QRATLDAEEM ADFYKDFLSK
160 170 180 190
NFQKHMRYNR DWYKRNFAIT FFMGKVVLER MWSKLRQKKT SS
Length:192
Mass (Da):22,715
Last modified:June 1, 2001 - v1
Checksum:i4DAC16ADC70CFC90
GO
Isoform 2 (identifier: Q9CQW7-2) [UniParc]FASTAAdd to basket
Also known as: Apop-1

The sequence of this isoform differs from the canonical sequence as follows:
     161-192: DWYKRNFAITFFMGKVVLERMWSKLRQKKTSS → AGPGSQDVGCVGKCSFAELHPYLTVSALQGSCPA

Show »
Length:194
Mass (Da):22,083
Checksum:i61A3EB0EE3FFFFC0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei161 – 19232DWYKR…KKTSS → AGPGSQDVGCVGKCSFAELH PYLTVSALQGSCPA in isoform 2. CuratedVSP_041973Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002873 mRNA. Translation: BAB22421.1.
AK005403 mRNA. Translation: BAB24003.1.
AK010493 mRNA. Translation: BAB26983.1.
AK012648 mRNA. Translation: BAB28380.1.
BC071262 mRNA. Translation: AAH71262.1.
CCDSiCCDS26186.1. [Q9CQW7-1]
CCDS49181.1. [Q9CQW7-2]
RefSeqiNP_001156860.1. NM_001163388.1. [Q9CQW7-2]
NP_080787.1. NM_026511.2. [Q9CQW7-1]
UniGeneiMm.425762.

Genome annotation databases

EnsembliENSMUST00000040519; ENSMUSP00000038865; ENSMUSG00000037787. [Q9CQW7-1]
ENSMUST00000163220; ENSMUSP00000131169; ENSMUSG00000037787. [Q9CQW7-2]
GeneIDi68020.
KEGGimmu:68020.
UCSCiuc007pdt.2. mouse. [Q9CQW7-1]
uc011yuy.1. mouse. [Q9CQW7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002873 mRNA. Translation: BAB22421.1.
AK005403 mRNA. Translation: BAB24003.1.
AK010493 mRNA. Translation: BAB26983.1.
AK012648 mRNA. Translation: BAB28380.1.
BC071262 mRNA. Translation: AAH71262.1.
CCDSiCCDS26186.1. [Q9CQW7-1]
CCDS49181.1. [Q9CQW7-2]
RefSeqiNP_001156860.1. NM_001163388.1. [Q9CQW7-2]
NP_080787.1. NM_026511.2. [Q9CQW7-1]
UniGeneiMm.425762.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000131169.

PTM databases

iPTMnetiQ9CQW7.
PhosphoSiteiQ9CQW7.

Proteomic databases

MaxQBiQ9CQW7.
PaxDbiQ9CQW7.
PRIDEiQ9CQW7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000040519; ENSMUSP00000038865; ENSMUSG00000037787. [Q9CQW7-1]
ENSMUST00000163220; ENSMUSP00000131169; ENSMUSG00000037787. [Q9CQW7-2]
GeneIDi68020.
KEGGimmu:68020.
UCSCiuc007pdt.2. mouse. [Q9CQW7-1]
uc011yuy.1. mouse. [Q9CQW7-2]

Organism-specific databases

CTDi84334.
MGIiMGI:1915270. Apopt1.

Phylogenomic databases

eggNOGiKOG4094. Eukaryota.
ENOG4111VRW. LUCA.
GeneTreeiENSGT00390000008212.
HOGENOMiHOG000111828.
HOVERGENiHBG074760.
InParanoidiQ9CQW7.
OMAiWIGPPNP.
OrthoDBiEOG091G0ZZ4.
PhylomeDBiQ9CQW7.
TreeFamiTF315168.

Miscellaneous databases

PROiQ9CQW7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000037787.
ExpressionAtlasiQ9CQW7. baseline and differential.
GenevisibleiQ9CQW7. MM.

Family and domain databases

InterProiIPR018796. UPF0671.
[Graphical view]
PfamiPF10231. DUF2315. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAPOP1_MOUSE
AccessioniPrimary (citable) accession number: Q9CQW7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 4, 2008
Last sequence update: June 1, 2001
Last modified: September 7, 2016
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.