Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial import inner membrane translocase subunit TIM14

Gene

Dnajc19

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).By similarity

GO - Biological processi

Keywordsi

Molecular functionChaperone
Biological processProtein transport, Translocation, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial import inner membrane translocase subunit TIM14
Alternative name(s):
DnaJ homolog subfamily C member 19
Gene namesi
Name:Dnajc19
Synonyms:Tim14, Timm14
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi

Organism-specific databases

MGIiMGI:1914963 Dnajc19

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 3Mitochondrial intermembraneSequence analysis2
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 116Mitochondrial matrixSequence analysisAdd BLAST92

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000711012 – 116Mitochondrial import inner membrane translocase subunit TIM14Add BLAST115

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei39PhosphoserineBy similarity1
Modified residuei70PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9CQV7
PRIDEiQ9CQV7

PTM databases

iPTMnetiQ9CQV7
PhosphoSitePlusiQ9CQV7

Expressioni

Gene expression databases

BgeeiENSMUSG00000027679
CleanExiMM_DNAJC19
ExpressionAtlasiQ9CQV7 baseline and differential
GenevisibleiQ9CQV7 MM

Interactioni

Subunit structurei

Probable component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000011029

Structurei

3D structure databases

ProteinModelPortaliQ9CQV7
SMRiQ9CQV7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini62 – 116JPROSITE-ProRule annotationAdd BLAST55

Sequence similaritiesi

Belongs to the TIM14 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0723 Eukaryota
COG2214 LUCA
GeneTreeiENSGT00390000017303
HOGENOMiHOG000115841
HOVERGENiHBG057483
InParanoidiQ9CQV7
KOiK09539
OMAiFDAESMA
PhylomeDBiQ9CQV7

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
PROSITEiView protein in PROSITE
PS50076 DNAJ_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CQV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASTVVAVGL TIAAAGFAGR YVLQAMKHVE PQVKQVFQSL PKSAFGGGYY
60 70 80 90 100
RGGFEPKMTK REAALILGVS PTANKGKIRD AHRRIMLLNH PDKGGSPYIA
110
AKINEAKDLL EGQAKK
Length:116
Mass (Da):12,437
Last modified:January 23, 2007 - v3
Checksum:i51E4313DB4F6083E
GO
Isoform 2 (identifier: Q9CQV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-116: GSPYIAAKINEAKDLLEGQAKK → PLVEEGLKPI...TPVKPCETTM

Note: No experimental confirmation available.
Show »
Length:157
Mass (Da):16,956
Checksum:i7D8BC9DF54F2BDAA
GO
Isoform 3 (identifier: Q9CQV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-116: GSPYIAAKINEAKDLLEGQAKK → KQLLLLYWTVNGIANSWCYECLCVSSFPVVDHIVVS

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):14,193
Checksum:iA7EE66196A6A7B2F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01639095 – 116GSPYI…GQAKK → PLVEEGLKPIPICRSCSSIC RRSILSCSTSYDQNKNPFTV CVCVHSSAHTGIHTPVKPCE TTM in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_01639195 – 116GSPYI…GQAKK → KQLLLLYWTVNGIANSWCYE CLCVSSFPVVDHIVVS in isoform 3. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007866 mRNA Translation: BAB25317.1
AK008267 mRNA Translation: BAB25565.1
AK010204 mRNA Translation: BAB26767.1
AK012051 mRNA Translation: BAB27993.1
BC024335 mRNA Translation: AAH24335.1
CCDSiCCDS38411.1 [Q9CQV7-2]
CCDS38412.1 [Q9CQV7-1]
CCDS71233.1 [Q9CQV7-3]
RefSeqiNP_001021382.1, NM_001026211.2
NP_001273901.1, NM_001286972.1 [Q9CQV7-3]
NP_001273902.1, NM_001286973.1
NP_080608.3, NM_026332.4 [Q9CQV7-1]
XP_003084767.1, XM_003084719.3 [Q9CQV7-1]
UniGeneiMm.274266

Genome annotation databases

EnsembliENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679 [Q9CQV7-1]
ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679 [Q9CQV7-3]
GeneIDi100503724
67713
KEGGimmu:100503724
mmu:67713
UCSCiuc008oxo.2 mouse [Q9CQV7-1]
uc008oxp.2 mouse [Q9CQV7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTIM14_MOUSE
AccessioniPrimary (citable) accession number: Q9CQV7
Secondary accession number(s): Q8R1N1, Q9D896
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: January 23, 2007
Last modified: May 23, 2018
This is version 133 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health