Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9CQV7

- TIM14_MOUSE

UniProt

Q9CQV7 - TIM14_MOUSE

Protein

Mitochondrial import inner membrane translocase subunit TIM14

Gene

Dnajc19

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
  1. Functioni

    Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity By similarity.By similarity

    GO - Biological processi

    1. protein transport Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chaperone

    Keywords - Biological processi

    Protein transport, Translocation, Transport

    Enzyme and pathway databases

    ReactomeiREACT_199101. Mitochondrial protein import.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mitochondrial import inner membrane translocase subunit TIM14
    Alternative name(s):
    DnaJ homolog subfamily C member 19
    Gene namesi
    Name:Dnajc19
    Synonyms:Tim14, Timm14
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 3

    Organism-specific databases

    MGIiMGI:1914963. Dnajc19.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrial inner membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 116115Mitochondrial import inner membrane translocase subunit TIM14PRO_0000071101Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei70 – 701PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9CQV7.
    PaxDbiQ9CQV7.
    PRIDEiQ9CQV7.

    PTM databases

    PhosphoSiteiQ9CQV7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9CQV7.
    BgeeiQ9CQV7.
    CleanExiMM_DNAJC19.
    GenevestigatoriQ9CQV7.

    Interactioni

    Subunit structurei

    Probable component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.By similarity

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000011029.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9CQV7.
    SMRiQ9CQV7. Positions 48-111.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini2 – 32Mitochondrial intermembraneSequence Analysis
    Topological domaini25 – 11692Mitochondrial matrixSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei4 – 2421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini62 – 11655JPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the TIM14 family.Curated
    Contains 1 J domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG250674.
    GeneTreeiENSGT00390000017303.
    HOGENOMiHOG000115841.
    HOVERGENiHBG057483.
    KOiK09539.
    OMAiHRKLMIL.
    PhylomeDBiQ9CQV7.

    Family and domain databases

    Gene3Di1.10.287.110. 1 hit.
    InterProiIPR001623. DnaJ_domain.
    [Graphical view]
    PfamiPF00226. DnaJ. 1 hit.
    [Graphical view]
    SMARTiSM00271. DnaJ. 1 hit.
    [Graphical view]
    SUPFAMiSSF46565. SSF46565. 1 hit.
    PROSITEiPS50076. DNAJ_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9CQV7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASTVVAVGL TIAAAGFAGR YVLQAMKHVE PQVKQVFQSL PKSAFGGGYY    50
    RGGFEPKMTK REAALILGVS PTANKGKIRD AHRRIMLLNH PDKGGSPYIA 100
    AKINEAKDLL EGQAKK 116
    Length:116
    Mass (Da):12,437
    Last modified:January 23, 2007 - v3
    Checksum:i51E4313DB4F6083E
    GO
    Isoform 2 (identifier: Q9CQV7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         95-116: GSPYIAAKINEAKDLLEGQAKK → PLVEEGLKPI...TPVKPCETTM

    Note: No experimental confirmation available.

    Show »
    Length:157
    Mass (Da):16,956
    Checksum:i7D8BC9DF54F2BDAA
    GO
    Isoform 3 (identifier: Q9CQV7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         95-116: GSPYIAAKINEAKDLLEGQAKK → KQLLLLYWTVNGIANSWCYECLCVSSFPVVDHIVVS

    Note: No experimental confirmation available.

    Show »
    Length:130
    Mass (Da):14,193
    Checksum:iA7EE66196A6A7B2F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei95 – 11622GSPYI…GQAKK → PLVEEGLKPIPICRSCSSIC RRSILSCSTSYDQNKNPFTV CVCVHSSAHTGIHTPVKPCE TTM in isoform 2. 1 PublicationVSP_016390Add
    BLAST
    Alternative sequencei95 – 11622GSPYI…GQAKK → KQLLLLYWTVNGIANSWCYE CLCVSSFPVVDHIVVS in isoform 3. 1 PublicationVSP_016391Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK007866 mRNA. Translation: BAB25317.1.
    AK008267 mRNA. Translation: BAB25565.1.
    AK010204 mRNA. Translation: BAB26767.1.
    AK012051 mRNA. Translation: BAB27993.1.
    BC024335 mRNA. Translation: AAH24335.1.
    CCDSiCCDS38411.1. [Q9CQV7-2]
    CCDS38412.1. [Q9CQV7-1]
    CCDS71233.1. [Q9CQV7-3]
    RefSeqiNP_001021382.1. NM_001026211.2.
    NP_001273901.1. NM_001286972.1. [Q9CQV7-3]
    NP_001273902.1. NM_001286973.1.
    NP_080608.3. NM_026332.4. [Q9CQV7-1]
    XP_003084767.1. XM_003084719.2. [Q9CQV7-1]
    UniGeneiMm.274266.

    Genome annotation databases

    EnsembliENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679. [Q9CQV7-1]
    ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679. [Q9CQV7-3]
    GeneIDi100503724.
    67713.
    KEGGimmu:100503724.
    mmu:67713.
    UCSCiuc008oxo.1. mouse. [Q9CQV7-1]
    uc008oxp.1. mouse. [Q9CQV7-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK007866 mRNA. Translation: BAB25317.1 .
    AK008267 mRNA. Translation: BAB25565.1 .
    AK010204 mRNA. Translation: BAB26767.1 .
    AK012051 mRNA. Translation: BAB27993.1 .
    BC024335 mRNA. Translation: AAH24335.1 .
    CCDSi CCDS38411.1. [Q9CQV7-2 ]
    CCDS38412.1. [Q9CQV7-1 ]
    CCDS71233.1. [Q9CQV7-3 ]
    RefSeqi NP_001021382.1. NM_001026211.2.
    NP_001273901.1. NM_001286972.1. [Q9CQV7-3 ]
    NP_001273902.1. NM_001286973.1.
    NP_080608.3. NM_026332.4. [Q9CQV7-1 ]
    XP_003084767.1. XM_003084719.2. [Q9CQV7-1 ]
    UniGenei Mm.274266.

    3D structure databases

    ProteinModelPortali Q9CQV7.
    SMRi Q9CQV7. Positions 48-111.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000011029.

    PTM databases

    PhosphoSitei Q9CQV7.

    Proteomic databases

    MaxQBi Q9CQV7.
    PaxDbi Q9CQV7.
    PRIDEi Q9CQV7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000108195 ; ENSMUSP00000103830 ; ENSMUSG00000027679 . [Q9CQV7-1 ]
    ENSMUST00000117223 ; ENSMUSP00000113484 ; ENSMUSG00000027679 . [Q9CQV7-3 ]
    GeneIDi 100503724.
    67713.
    KEGGi mmu:100503724.
    mmu:67713.
    UCSCi uc008oxo.1. mouse. [Q9CQV7-1 ]
    uc008oxp.1. mouse. [Q9CQV7-3 ]

    Organism-specific databases

    CTDi 100503724.
    131118.
    MGIi MGI:1914963. Dnajc19.

    Phylogenomic databases

    eggNOGi NOG250674.
    GeneTreei ENSGT00390000017303.
    HOGENOMi HOG000115841.
    HOVERGENi HBG057483.
    KOi K09539.
    OMAi HRKLMIL.
    PhylomeDBi Q9CQV7.

    Enzyme and pathway databases

    Reactomei REACT_199101. Mitochondrial protein import.

    Miscellaneous databases

    NextBioi 325345.
    PROi Q9CQV7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9CQV7.
    Bgeei Q9CQV7.
    CleanExi MM_DNAJC19.
    Genevestigatori Q9CQV7.

    Family and domain databases

    Gene3Di 1.10.287.110. 1 hit.
    InterProi IPR001623. DnaJ_domain.
    [Graphical view ]
    Pfami PF00226. DnaJ. 1 hit.
    [Graphical view ]
    SMARTi SM00271. DnaJ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46565. SSF46565. 1 hit.
    PROSITEi PS50076. DNAJ_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J.
      Tissue: Pancreas, Small intestine and Tongue.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: FVB/N.
      Tissue: Kidney.

    Entry informationi

    Entry nameiTIM14_MOUSE
    AccessioniPrimary (citable) accession number: Q9CQV7
    Secondary accession number(s): Q8R1N1, Q9D896
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 6, 2005
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 103 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3