Q9CQV7 (TIM14_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): DnaJ homolog subfamily C member 19 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 116 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity By similarity. |
| Subunit structure | Probable component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19 By similarity. |
| Subcellular location | Mitochondrion inner membrane; Single-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the TIM14 family. Contains 1 J domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Translocation Transport |
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Chaperone |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW mitochondrial inner membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9CQV7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9CQV7-2) The sequence of this isoform differs from the canonical sequence as follows: 95-116: GSPYIAAKINEAKDLLEGQAKK → PLVEEGLKPI...TPVKPCETTM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9CQV7-3) The sequence of this isoform differs from the canonical sequence as follows: 95-116: GSPYIAAKINEAKDLLEGQAKK → KQLLLLYWTVNGIANSWCYECLCVSSFPVVDHIVVS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 116 | 115 | Mitochondrial import inner membrane translocase subunit TIM14 | PRO_0000071101 | |||||
Regions | |||||||||
| Topological domain | 2 – 3 | 2 | Mitochondrial intermembrane Potential | ||||||
| Transmembrane | 4 – 24 | 21 | Helical; Potential | ||||||
| Topological domain | 25 – 116 | 92 | Mitochondrial matrix Potential | ||||||
| Domain | 62 – 116 | 55 | J | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||
| Modified residue | 70 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 95 – 116 | 22 | GSPYI…GQAKK → PLVEEGLKPIPICRSCSSIC RRSILSCSTSYDQNKNPFTV CVCVHSSAHTGIHTPVKPCE TTM in isoform 2. | VSP_016390 | |||||
| Alternative sequence | 95 – 116 | 22 | GSPYI…GQAKK → KQLLLLYWTVNGIANSWCYE CLCVSSFPVVDHIVVS in isoform 3. | VSP_016391 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Pancreas, Small intestine and Tongue. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: FVB/N. Tissue: Kidney. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK007866 mRNA. Translation: BAB25317.1. AK008267 mRNA. Translation: BAB25565.1. AK010204 mRNA. Translation: BAB26767.1. AK012051 mRNA. Translation: BAB27993.1. BC024335 mRNA. Translation: AAH24335.1. |
| IPI | IPI00111111. IPI00468992. IPI00624902. |
| RefSeq | NP_001021382.1. NM_001026211.1. NP_080608.3. NM_026332.3. XP_003084767.1. XM_003084719.1. |
| UniGene | Mm.274266. Mm.389927. |
3D structure databases | |
| ProteinModelPortal | Q9CQV7. |
| SMR | Q9CQV7. Positions 48-111. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000011029. |
PTM databases | |
| PhosphoSite | Q9CQV7. |
Proteomic databases | |
| PaxDb | Q9CQV7. |
| PRIDE | Q9CQV7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679. ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679. |
| GeneID | 100503724. 67713. |
| KEGG | mmu:100503724. mmu:67713. |
| UCSC | uc008oxm.1. mouse. uc008oxo.1. mouse. uc008oxp.1. mouse. |
Organism-specific databases | |
| CTD | 131118. |
| MGI | MGI:1914963. Dnajc19. |
Phylogenomic databases | |
| eggNOG | NOG250674. |
| GeneTree | ENSGT00390000017303. |
| HOGENOM | HOG000115841. |
| HOVERGEN | HBG057483. |
| KO | K09539. |
| OMA | NKIREAH. |
| OrthoDB | EOG43XV50. |
Gene expression databases | |
| ArrayExpress | Q9CQV7. |
| Bgee | Q9CQV7. |
| CleanEx | MM_DNAJC19. |
| Genevestigator | Q9CQV7. |
| GermOnline | ENSMUSG00000057330. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.287.110. 1 hit. |
| InterPro | IPR001623. DnaJ_domain. [Graphical view] |
| Pfam | PF00226. DnaJ. 1 hit. [Graphical view] |
| SMART | SM00271. DnaJ. 1 hit. [Graphical view] |
| SUPFAM | SSF46565. DnaJ_N. 1 hit. |
| PROSITE | PS00636. DNAJ_1. False negative. PS50076. DNAJ_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 325345. |
| SOURCE | Search... |
Entry information
| Entry name | TIM14_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9CQV7 Secondary accession number(s): Q8R1N1, Q9D896 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
