Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial import inner membrane translocase subunit TIM14

Gene

Dnajc19

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Biological processi

Protein transport, Translocation, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial import inner membrane translocase subunit TIM14
Alternative name(s):
DnaJ homolog subfamily C member 19
Gene namesi
Name:Dnajc19
Synonyms:Tim14, Timm14
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1914963. Dnajc19.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 3Mitochondrial intermembraneSequence analysis2
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 116Mitochondrial matrixSequence analysisAdd BLAST92

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000711012 – 116Mitochondrial import inner membrane translocase subunit TIM14Add BLAST115

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei39PhosphoserineBy similarity1
Modified residuei70PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9CQV7.
PRIDEiQ9CQV7.

PTM databases

iPTMnetiQ9CQV7.
PhosphoSitePlusiQ9CQV7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000027679.
CleanExiMM_DNAJC19.
ExpressionAtlasiQ9CQV7. baseline and differential.
GenevisibleiQ9CQV7. MM.

Interactioni

Subunit structurei

Probable component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000011029.

Structurei

3D structure databases

ProteinModelPortaliQ9CQV7.
SMRiQ9CQV7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini62 – 116JPROSITE-ProRule annotationAdd BLAST55

Sequence similaritiesi

Belongs to the TIM14 family.Curated
Contains 1 J domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0723. Eukaryota.
COG2214. LUCA.
GeneTreeiENSGT00390000017303.
HOGENOMiHOG000115841.
HOVERGENiHBG057483.
InParanoidiQ9CQV7.
KOiK09539.
OMAiFAGKHLI.
PhylomeDBiQ9CQV7.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
[Graphical view]
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS50076. DNAJ_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CQV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASTVVAVGL TIAAAGFAGR YVLQAMKHVE PQVKQVFQSL PKSAFGGGYY
60 70 80 90 100
RGGFEPKMTK REAALILGVS PTANKGKIRD AHRRIMLLNH PDKGGSPYIA
110
AKINEAKDLL EGQAKK
Length:116
Mass (Da):12,437
Last modified:January 23, 2007 - v3
Checksum:i51E4313DB4F6083E
GO
Isoform 2 (identifier: Q9CQV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-116: GSPYIAAKINEAKDLLEGQAKK → PLVEEGLKPI...TPVKPCETTM

Note: No experimental confirmation available.
Show »
Length:157
Mass (Da):16,956
Checksum:i7D8BC9DF54F2BDAA
GO
Isoform 3 (identifier: Q9CQV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-116: GSPYIAAKINEAKDLLEGQAKK → KQLLLLYWTVNGIANSWCYECLCVSSFPVVDHIVVS

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):14,193
Checksum:iA7EE66196A6A7B2F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01639095 – 116GSPYI…GQAKK → PLVEEGLKPIPICRSCSSIC RRSILSCSTSYDQNKNPFTV CVCVHSSAHTGIHTPVKPCE TTM in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_01639195 – 116GSPYI…GQAKK → KQLLLLYWTVNGIANSWCYE CLCVSSFPVVDHIVVS in isoform 3. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007866 mRNA. Translation: BAB25317.1.
AK008267 mRNA. Translation: BAB25565.1.
AK010204 mRNA. Translation: BAB26767.1.
AK012051 mRNA. Translation: BAB27993.1.
BC024335 mRNA. Translation: AAH24335.1.
CCDSiCCDS38411.1. [Q9CQV7-2]
CCDS38412.1. [Q9CQV7-1]
CCDS71233.1. [Q9CQV7-3]
RefSeqiNP_001021382.1. NM_001026211.2.
NP_001273901.1. NM_001286972.1. [Q9CQV7-3]
NP_001273902.1. NM_001286973.1.
NP_080608.3. NM_026332.4. [Q9CQV7-1]
XP_003084767.1. XM_003084719.3. [Q9CQV7-1]
UniGeneiMm.274266.

Genome annotation databases

EnsembliENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679. [Q9CQV7-1]
ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679. [Q9CQV7-3]
GeneIDi100503724.
67713.
KEGGimmu:100503724.
mmu:67713.
UCSCiuc008oxo.2. mouse. [Q9CQV7-1]
uc008oxp.2. mouse. [Q9CQV7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007866 mRNA. Translation: BAB25317.1.
AK008267 mRNA. Translation: BAB25565.1.
AK010204 mRNA. Translation: BAB26767.1.
AK012051 mRNA. Translation: BAB27993.1.
BC024335 mRNA. Translation: AAH24335.1.
CCDSiCCDS38411.1. [Q9CQV7-2]
CCDS38412.1. [Q9CQV7-1]
CCDS71233.1. [Q9CQV7-3]
RefSeqiNP_001021382.1. NM_001026211.2.
NP_001273901.1. NM_001286972.1. [Q9CQV7-3]
NP_001273902.1. NM_001286973.1.
NP_080608.3. NM_026332.4. [Q9CQV7-1]
XP_003084767.1. XM_003084719.3. [Q9CQV7-1]
UniGeneiMm.274266.

3D structure databases

ProteinModelPortaliQ9CQV7.
SMRiQ9CQV7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000011029.

PTM databases

iPTMnetiQ9CQV7.
PhosphoSitePlusiQ9CQV7.

Proteomic databases

PaxDbiQ9CQV7.
PRIDEiQ9CQV7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679. [Q9CQV7-1]
ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679. [Q9CQV7-3]
GeneIDi100503724.
67713.
KEGGimmu:100503724.
mmu:67713.
UCSCiuc008oxo.2. mouse. [Q9CQV7-1]
uc008oxp.2. mouse. [Q9CQV7-3]

Organism-specific databases

CTDi100503724.
131118.
MGIiMGI:1914963. Dnajc19.

Phylogenomic databases

eggNOGiKOG0723. Eukaryota.
COG2214. LUCA.
GeneTreeiENSGT00390000017303.
HOGENOMiHOG000115841.
HOVERGENiHBG057483.
InParanoidiQ9CQV7.
KOiK09539.
OMAiFAGKHLI.
PhylomeDBiQ9CQV7.

Miscellaneous databases

ChiTaRSiDnajc19. mouse.
PROiQ9CQV7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027679.
CleanExiMM_DNAJC19.
ExpressionAtlasiQ9CQV7. baseline and differential.
GenevisibleiQ9CQV7. MM.

Family and domain databases

CDDicd06257. DnaJ. 1 hit.
Gene3Di1.10.287.110. 1 hit.
InterProiIPR001623. DnaJ_domain.
[Graphical view]
PfamiPF00226. DnaJ. 1 hit.
[Graphical view]
SMARTiSM00271. DnaJ. 1 hit.
[Graphical view]
SUPFAMiSSF46565. SSF46565. 1 hit.
PROSITEiPS50076. DNAJ_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTIM14_MOUSE
AccessioniPrimary (citable) accession number: Q9CQV7
Secondary accession number(s): Q8R1N1, Q9D896
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: January 23, 2007
Last modified: November 2, 2016
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.