Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9CQC8 (SPG21_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Maspardin
Alternative name(s):
Acid cluster protein 33
Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog
Gene names
Name:Spg21
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length308 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role as a negative regulatory factor in CD4-dependent T-cell activation By similarity.

Subunit structure

Interacts with CD4 By similarity. Interacts with ALDH16A1 By similarity.

Subcellular location

Cytoplasm By similarity.

Tissue specificity

Expressed in cell lines FT.1 and in a L cell fibroblast derivative (at protein level). Ref.3

Sequence similarities

Belongs to the AB hydrolase superfamily.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9CQC8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9CQC8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     271-308: IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP → VSPAWTPEHVRFRDPPQDSAP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 308308Maspardin
PRO_0000227982

Amino acid modifications

Modified residue3041Phosphoserine By similarity

Natural variations

Alternative sequence271 – 30838IHLLQ…SQEEP → VSPAWTPEHVRFRDPPQDSA P in isoform 2.
VSP_017634

Experimental info

Sequence conflict2781G → V in BAE29174. Ref.1
Sequence conflict2921E → G in BAE31867. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 9E312FCB0865CBB5

FASTA30834,952
        10         20         30         40         50         60 
MGEIKVSPDY NWFRSTVPLK KIIVDDDDSK IWSLYDAGPR SIRCPLIFLP PVSGTADVFF 

        70         80         90        100        110        120 
QQILALTGWG YRVIALQYPV YWDHLEFCDG FRKLLDHLQL DKVHLFGASL GGFLAQKFAE 

       130        140        150        160        170        180 
YTHKSPRVHS LILCNAFSDT SIFNQTWTAN SFWLMPAFML KKIVLGNFSS GPVDPMMADA 

       190        200        210        220        230        240 
IDFMVDRLES LGQSELASRL TLNCQNSYVE PHKIRDIPVT IMDVFDQSAL STEAKEEMYK 

       250        260        270        280        290        300 
LYPNARRAHL KTGGNFPYLC RSAEVNLYVQ IHLLQFHGTK YAAIDPSVVS AEELEVQKGR 


LGLSQEEP 

« Hide

Isoform 2 [UniParc].

Checksum: 8CB2A030E571760B
Show »

FASTA29133,151

References

« Hide 'large scale' references
[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J and NOD.
Tissue: Bone marrow, Dendritic cell, Embryo and Tongue.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.
[3]"Cloning of ACP33 as a novel intracellular ligand of CD4."
Zeitlmann L., Sirim P., Kremmer E., Kolanus W.
J. Biol. Chem. 276:9123-9132(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK009332 mRNA. Translation: BAB26224.1.
AK011985 mRNA. Translation: BAB27958.1.
AK090017 mRNA. Translation: BAC41047.1.
AK149930 mRNA. Translation: BAE29174.1.
AK150215 mRNA. Translation: BAE29385.1.
AK150581 mRNA. Translation: BAE29675.1.
AK153284 mRNA. Translation: BAE31867.1.
AK170666 mRNA. Translation: BAE41947.1.
BC099434 mRNA. Translation: AAH99434.1.
CCDSCCDS23293.1. [Q9CQC8-1]
RefSeqNP_613050.1. NM_138584.2. [Q9CQC8-1]
XP_006511285.1. XM_006511222.1. [Q9CQC8-1]
UniGeneMm.272475.

3D structure databases

ProteinModelPortalQ9CQC8.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10090.ENSMUSP00000034955.

PTM databases

PhosphoSiteQ9CQC8.

Proteomic databases

MaxQBQ9CQC8.
PaxDbQ9CQC8.
PRIDEQ9CQC8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000034955; ENSMUSP00000034955; ENSMUSG00000032388. [Q9CQC8-1]
GeneID27965.
KEGGmmu:27965.
UCSCuc009qdi.1. mouse. [Q9CQC8-1]

Organism-specific databases

CTD51324.
MGIMGI:106403. Spg21.

Phylogenomic databases

eggNOGNOG77636.
GeneTreeENSGT00390000007857.
HOGENOMHOG000236323.
HOVERGENHBG080704.
InParanoidQ9CQC8.
OMASLQYPVY.
OrthoDBEOG7F5120.
PhylomeDBQ9CQC8.
TreeFamTF105253.

Gene expression databases

ArrayExpressQ9CQC8.
BgeeQ9CQC8.
CleanExMM_SPG21.
GenevestigatorQ9CQC8.

Family and domain databases

Gene3D3.40.50.1820. 1 hit.
InterProIPR029058. AB_hydrolase.
IPR026151. Maspardin.
[Graphical view]
PANTHERPTHR15913. PTHR15913. 1 hit.
SUPFAMSSF53474. SSF53474. 1 hit.
ProtoNetSearch...

Other

NextBio306452.
PROQ9CQC8.
SOURCESearch...

Entry information

Entry nameSPG21_MOUSE
AccessionPrimary (citable) accession number: Q9CQC8
Secondary accession number(s): Q3U658, Q3UDT7, Q8C1Y7
Entry history
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot