Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Maspardin

Gene

Spg21

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a negative regulatory factor in CD4-dependent T-cell activation.By similarity

GO - Molecular functioni

  1. CD4 receptor binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Maspardin
Alternative name(s):
Acid cluster protein 33
Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog
Gene namesi
Name:Spg21
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:106403. Spg21.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. cytosol Source: UniProtKB
  3. nucleoplasm Source: MGI
  4. nucleus Source: MGI
  5. trans-Golgi network transport vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 308308MaspardinPRO_0000227982Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei304 – 3041PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9CQC8.
PaxDbiQ9CQC8.
PRIDEiQ9CQC8.

PTM databases

PhosphoSiteiQ9CQC8.

Expressioni

Tissue specificityi

Expressed in cell lines FT.1 and in a L cell fibroblast derivative (at protein level).1 Publication

Gene expression databases

BgeeiQ9CQC8.
CleanExiMM_SPG21.
ExpressionAtlasiQ9CQC8. baseline and differential.
GenevestigatoriQ9CQC8.

Interactioni

Subunit structurei

Interacts with CD4. Interacts with ALDH16A1.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034955.

Structurei

3D structure databases

ProteinModelPortaliQ9CQC8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily.Curated

Phylogenomic databases

eggNOGiNOG77636.
GeneTreeiENSGT00390000007857.
HOGENOMiHOG000236323.
HOVERGENiHBG080704.
InParanoidiQ9CQC8.
OMAiADGIDFM.
OrthoDBiEOG7F5120.
PhylomeDBiQ9CQC8.
TreeFamiTF105253.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR000073. AB_hydrolase_1.
IPR026151. Maspardin.
[Graphical view]
PANTHERiPTHR15913. PTHR15913. 1 hit.
PfamiPF12697. Abhydrolase_6. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CQC8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEIKVSPDY NWFRSTVPLK KIIVDDDDSK IWSLYDAGPR SIRCPLIFLP
60 70 80 90 100
PVSGTADVFF QQILALTGWG YRVIALQYPV YWDHLEFCDG FRKLLDHLQL
110 120 130 140 150
DKVHLFGASL GGFLAQKFAE YTHKSPRVHS LILCNAFSDT SIFNQTWTAN
160 170 180 190 200
SFWLMPAFML KKIVLGNFSS GPVDPMMADA IDFMVDRLES LGQSELASRL
210 220 230 240 250
TLNCQNSYVE PHKIRDIPVT IMDVFDQSAL STEAKEEMYK LYPNARRAHL
260 270 280 290 300
KTGGNFPYLC RSAEVNLYVQ IHLLQFHGTK YAAIDPSVVS AEELEVQKGR

LGLSQEEP
Length:308
Mass (Da):34,952
Last modified:May 31, 2001 - v1
Checksum:i9E312FCB0865CBB5
GO
Isoform 2 (identifier: Q9CQC8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-308: IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP → VSPAWTPEHVRFRDPPQDSAP

Note: No experimental confirmation available.

Show »
Length:291
Mass (Da):33,151
Checksum:i8CB2A030E571760B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti278 – 2781G → V in BAE29174 (PubMed:16141072).Curated
Sequence conflicti292 – 2921E → G in BAE31867 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei271 – 30838IHLLQ…SQEEP → VSPAWTPEHVRFRDPPQDSA P in isoform 2. 1 PublicationVSP_017634Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK009332 mRNA. Translation: BAB26224.1.
AK011985 mRNA. Translation: BAB27958.1.
AK090017 mRNA. Translation: BAC41047.1.
AK149930 mRNA. Translation: BAE29174.1.
AK150215 mRNA. Translation: BAE29385.1.
AK150581 mRNA. Translation: BAE29675.1.
AK153284 mRNA. Translation: BAE31867.1.
AK170666 mRNA. Translation: BAE41947.1.
BC099434 mRNA. Translation: AAH99434.1.
CCDSiCCDS23293.1. [Q9CQC8-1]
RefSeqiNP_613050.1. NM_138584.2. [Q9CQC8-1]
XP_006511285.1. XM_006511222.2. [Q9CQC8-1]
UniGeneiMm.272475.

Genome annotation databases

EnsembliENSMUST00000034955; ENSMUSP00000034955; ENSMUSG00000032388. [Q9CQC8-1]
GeneIDi27965.
KEGGimmu:27965.
UCSCiuc009qdi.1. mouse. [Q9CQC8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK009332 mRNA. Translation: BAB26224.1.
AK011985 mRNA. Translation: BAB27958.1.
AK090017 mRNA. Translation: BAC41047.1.
AK149930 mRNA. Translation: BAE29174.1.
AK150215 mRNA. Translation: BAE29385.1.
AK150581 mRNA. Translation: BAE29675.1.
AK153284 mRNA. Translation: BAE31867.1.
AK170666 mRNA. Translation: BAE41947.1.
BC099434 mRNA. Translation: AAH99434.1.
CCDSiCCDS23293.1. [Q9CQC8-1]
RefSeqiNP_613050.1. NM_138584.2. [Q9CQC8-1]
XP_006511285.1. XM_006511222.2. [Q9CQC8-1]
UniGeneiMm.272475.

3D structure databases

ProteinModelPortaliQ9CQC8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034955.

PTM databases

PhosphoSiteiQ9CQC8.

Proteomic databases

MaxQBiQ9CQC8.
PaxDbiQ9CQC8.
PRIDEiQ9CQC8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034955; ENSMUSP00000034955; ENSMUSG00000032388. [Q9CQC8-1]
GeneIDi27965.
KEGGimmu:27965.
UCSCiuc009qdi.1. mouse. [Q9CQC8-1]

Organism-specific databases

CTDi51324.
MGIiMGI:106403. Spg21.

Phylogenomic databases

eggNOGiNOG77636.
GeneTreeiENSGT00390000007857.
HOGENOMiHOG000236323.
HOVERGENiHBG080704.
InParanoidiQ9CQC8.
OMAiADGIDFM.
OrthoDBiEOG7F5120.
PhylomeDBiQ9CQC8.
TreeFamiTF105253.

Miscellaneous databases

NextBioi306452.
PROiQ9CQC8.
SOURCEiSearch...

Gene expression databases

BgeeiQ9CQC8.
CleanExiMM_SPG21.
ExpressionAtlasiQ9CQC8. baseline and differential.
GenevestigatoriQ9CQC8.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR000073. AB_hydrolase_1.
IPR026151. Maspardin.
[Graphical view]
PANTHERiPTHR15913. PTHR15913. 1 hit.
PfamiPF12697. Abhydrolase_6. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow, Dendritic cell, Embryo and Tongue.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. "Cloning of ACP33 as a novel intracellular ligand of CD4."
    Zeitlmann L., Sirim P., Kremmer E., Kolanus W.
    J. Biol. Chem. 276:9123-9132(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiSPG21_MOUSE
AccessioniPrimary (citable) accession number: Q9CQC8
Secondary accession number(s): Q3U658, Q3UDT7, Q8C1Y7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2006
Last sequence update: May 31, 2001
Last modified: March 31, 2015
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.