Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9CQC8

- SPG21_MOUSE

UniProt

Q9CQC8 - SPG21_MOUSE

Protein

Maspardin

Gene

Spg21

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role as a negative regulatory factor in CD4-dependent T-cell activation.By similarity

    GO - Molecular functioni

    1. CD4 receptor binding Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Maspardin
    Alternative name(s):
    Acid cluster protein 33
    Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog
    Gene namesi
    Name:Spg21
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 9

    Organism-specific databases

    MGIiMGI:106403. Spg21.

    Subcellular locationi

    Cytoplasm By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. nucleus Source: Ensembl
    3. trans-Golgi network transport vesicle Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 308308MaspardinPRO_0000227982Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei304 – 3041PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9CQC8.
    PaxDbiQ9CQC8.
    PRIDEiQ9CQC8.

    PTM databases

    PhosphoSiteiQ9CQC8.

    Expressioni

    Tissue specificityi

    Expressed in cell lines FT.1 and in a L cell fibroblast derivative (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ9CQC8.
    BgeeiQ9CQC8.
    CleanExiMM_SPG21.
    GenevestigatoriQ9CQC8.

    Interactioni

    Subunit structurei

    Interacts with CD4. Interacts with ALDH16A1.By similarity

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000034955.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9CQC8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the AB hydrolase superfamily.Curated

    Phylogenomic databases

    eggNOGiNOG77636.
    GeneTreeiENSGT00390000007857.
    HOGENOMiHOG000236323.
    HOVERGENiHBG080704.
    InParanoidiQ9CQC8.
    OMAiSLQYPVY.
    OrthoDBiEOG7F5120.
    PhylomeDBiQ9CQC8.
    TreeFamiTF105253.

    Family and domain databases

    Gene3Di3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR026151. Maspardin.
    [Graphical view]
    PANTHERiPTHR15913. PTHR15913. 1 hit.
    SUPFAMiSSF53474. SSF53474. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9CQC8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGEIKVSPDY NWFRSTVPLK KIIVDDDDSK IWSLYDAGPR SIRCPLIFLP    50
    PVSGTADVFF QQILALTGWG YRVIALQYPV YWDHLEFCDG FRKLLDHLQL 100
    DKVHLFGASL GGFLAQKFAE YTHKSPRVHS LILCNAFSDT SIFNQTWTAN 150
    SFWLMPAFML KKIVLGNFSS GPVDPMMADA IDFMVDRLES LGQSELASRL 200
    TLNCQNSYVE PHKIRDIPVT IMDVFDQSAL STEAKEEMYK LYPNARRAHL 250
    KTGGNFPYLC RSAEVNLYVQ IHLLQFHGTK YAAIDPSVVS AEELEVQKGR 300
    LGLSQEEP 308
    Length:308
    Mass (Da):34,952
    Last modified:June 1, 2001 - v1
    Checksum:i9E312FCB0865CBB5
    GO
    Isoform 2 (identifier: Q9CQC8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         271-308: IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP → VSPAWTPEHVRFRDPPQDSAP

    Note: No experimental confirmation available.

    Show »
    Length:291
    Mass (Da):33,151
    Checksum:i8CB2A030E571760B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti278 – 2781G → V in BAE29174. (PubMed:16141072)Curated
    Sequence conflicti292 – 2921E → G in BAE31867. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei271 – 30838IHLLQ…SQEEP → VSPAWTPEHVRFRDPPQDSA P in isoform 2. 1 PublicationVSP_017634Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK009332 mRNA. Translation: BAB26224.1.
    AK011985 mRNA. Translation: BAB27958.1.
    AK090017 mRNA. Translation: BAC41047.1.
    AK149930 mRNA. Translation: BAE29174.1.
    AK150215 mRNA. Translation: BAE29385.1.
    AK150581 mRNA. Translation: BAE29675.1.
    AK153284 mRNA. Translation: BAE31867.1.
    AK170666 mRNA. Translation: BAE41947.1.
    BC099434 mRNA. Translation: AAH99434.1.
    CCDSiCCDS23293.1. [Q9CQC8-1]
    RefSeqiNP_613050.1. NM_138584.2. [Q9CQC8-1]
    XP_006511285.1. XM_006511222.1. [Q9CQC8-1]
    UniGeneiMm.272475.

    Genome annotation databases

    EnsembliENSMUST00000034955; ENSMUSP00000034955; ENSMUSG00000032388. [Q9CQC8-1]
    GeneIDi27965.
    KEGGimmu:27965.
    UCSCiuc009qdi.1. mouse. [Q9CQC8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK009332 mRNA. Translation: BAB26224.1 .
    AK011985 mRNA. Translation: BAB27958.1 .
    AK090017 mRNA. Translation: BAC41047.1 .
    AK149930 mRNA. Translation: BAE29174.1 .
    AK150215 mRNA. Translation: BAE29385.1 .
    AK150581 mRNA. Translation: BAE29675.1 .
    AK153284 mRNA. Translation: BAE31867.1 .
    AK170666 mRNA. Translation: BAE41947.1 .
    BC099434 mRNA. Translation: AAH99434.1 .
    CCDSi CCDS23293.1. [Q9CQC8-1 ]
    RefSeqi NP_613050.1. NM_138584.2. [Q9CQC8-1 ]
    XP_006511285.1. XM_006511222.1. [Q9CQC8-1 ]
    UniGenei Mm.272475.

    3D structure databases

    ProteinModelPortali Q9CQC8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000034955.

    PTM databases

    PhosphoSitei Q9CQC8.

    Proteomic databases

    MaxQBi Q9CQC8.
    PaxDbi Q9CQC8.
    PRIDEi Q9CQC8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000034955 ; ENSMUSP00000034955 ; ENSMUSG00000032388 . [Q9CQC8-1 ]
    GeneIDi 27965.
    KEGGi mmu:27965.
    UCSCi uc009qdi.1. mouse. [Q9CQC8-1 ]

    Organism-specific databases

    CTDi 51324.
    MGIi MGI:106403. Spg21.

    Phylogenomic databases

    eggNOGi NOG77636.
    GeneTreei ENSGT00390000007857.
    HOGENOMi HOG000236323.
    HOVERGENi HBG080704.
    InParanoidi Q9CQC8.
    OMAi SLQYPVY.
    OrthoDBi EOG7F5120.
    PhylomeDBi Q9CQC8.
    TreeFami TF105253.

    Miscellaneous databases

    NextBioi 306452.
    PROi Q9CQC8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9CQC8.
    Bgeei Q9CQC8.
    CleanExi MM_SPG21.
    Genevestigatori Q9CQC8.

    Family and domain databases

    Gene3Di 3.40.50.1820. 1 hit.
    InterProi IPR029058. AB_hydrolase.
    IPR026151. Maspardin.
    [Graphical view ]
    PANTHERi PTHR15913. PTHR15913. 1 hit.
    SUPFAMi SSF53474. SSF53474. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J and NOD.
      Tissue: Bone marrow, Dendritic cell, Embryo and Tongue.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta.
    3. "Cloning of ACP33 as a novel intracellular ligand of CD4."
      Zeitlmann L., Sirim P., Kremmer E., Kolanus W.
      J. Biol. Chem. 276:9123-9132(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiSPG21_MOUSE
    AccessioniPrimary (citable) accession number: Q9CQC8
    Secondary accession number(s): Q3U658, Q3UDT7, Q8C1Y7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 21, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 92 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3