Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Maspardin

Gene

Spg21

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role as a negative regulatory factor in CD4-dependent T-cell activation.By similarity

GO - Molecular functioni

Protein family/group databases

ESTHERimouse-SPG21 Maspardin-ACP33-SPG21_like

Names & Taxonomyi

Protein namesi
Recommended name:
Maspardin
Alternative name(s):
Acid cluster protein 33
Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog
Gene namesi
Name:Spg21
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:106403 Spg21

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002279821 – 308MaspardinAdd BLAST308

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei304PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9CQC8
PaxDbiQ9CQC8
PeptideAtlasiQ9CQC8
PRIDEiQ9CQC8

PTM databases

iPTMnetiQ9CQC8
PhosphoSitePlusiQ9CQC8

Expressioni

Tissue specificityi

Expressed in cell lines FT.1 and in a L cell fibroblast derivative (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000032388
CleanExiMM_SPG21
ExpressionAtlasiQ9CQC8 baseline and differential
GenevisibleiQ9CQC8 MM

Interactioni

Subunit structurei

Interacts with CD4. Interacts with ALDH16A1.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034955

Structurei

3D structure databases

ProteinModelPortaliQ9CQC8
SMRiQ9CQC8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini87 – 159AB hydrolase-1Sequence analysisAdd BLAST73

Sequence similaritiesi

Belongs to the AB hydrolase superfamily.Curated

Phylogenomic databases

eggNOGiENOG410IETY Eukaryota
ENOG410XPCG LUCA
GeneTreeiENSGT00390000007857
HOGENOMiHOG000236323
HOVERGENiHBG080704
InParanoidiQ9CQC8
KOiK19367
OMAiGIDFMVD
OrthoDBiEOG091G0GY0
PhylomeDBiQ9CQC8
TreeFamiTF105253

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR000073 AB_hydrolase_1
IPR026151 Maspardin
PANTHERiPTHR15913 PTHR15913, 1 hit
PfamiView protein in Pfam
PF00561 Abhydrolase_1, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CQC8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGEIKVSPDY NWFRSTVPLK KIIVDDDDSK IWSLYDAGPR SIRCPLIFLP
60 70 80 90 100
PVSGTADVFF QQILALTGWG YRVIALQYPV YWDHLEFCDG FRKLLDHLQL
110 120 130 140 150
DKVHLFGASL GGFLAQKFAE YTHKSPRVHS LILCNAFSDT SIFNQTWTAN
160 170 180 190 200
SFWLMPAFML KKIVLGNFSS GPVDPMMADA IDFMVDRLES LGQSELASRL
210 220 230 240 250
TLNCQNSYVE PHKIRDIPVT IMDVFDQSAL STEAKEEMYK LYPNARRAHL
260 270 280 290 300
KTGGNFPYLC RSAEVNLYVQ IHLLQFHGTK YAAIDPSVVS AEELEVQKGR

LGLSQEEP
Length:308
Mass (Da):34,952
Last modified:June 1, 2001 - v1
Checksum:i9E312FCB0865CBB5
GO
Isoform 2 (identifier: Q9CQC8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-308: IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP → VSPAWTPEHVRFRDPPQDSAP

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):33,151
Checksum:i8CB2A030E571760B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti278G → V in BAE29174 (PubMed:16141072).Curated1
Sequence conflicti292E → G in BAE31867 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017634271 – 308IHLLQ…SQEEP → VSPAWTPEHVRFRDPPQDSA P in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK009332 mRNA Translation: BAB26224.1
AK011985 mRNA Translation: BAB27958.1
AK090017 mRNA Translation: BAC41047.1
AK149930 mRNA Translation: BAE29174.1
AK150215 mRNA Translation: BAE29385.1
AK150581 mRNA Translation: BAE29675.1
AK153284 mRNA Translation: BAE31867.1
AK170666 mRNA Translation: BAE41947.1
BC099434 mRNA Translation: AAH99434.1
CCDSiCCDS23293.1 [Q9CQC8-1]
RefSeqiNP_613050.1, NM_138584.2 [Q9CQC8-1]
XP_006511285.1, XM_006511222.3
UniGeneiMm.272475

Genome annotation databases

EnsembliENSMUST00000034955; ENSMUSP00000034955; ENSMUSG00000032388 [Q9CQC8-1]
GeneIDi27965
KEGGimmu:27965
UCSCiuc009qdi.1 mouse [Q9CQC8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSPG21_MOUSE
AccessioniPrimary (citable) accession number: Q9CQC8
Secondary accession number(s): Q3U658, Q3UDT7, Q8C1Y7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: June 1, 2001
Last modified: April 25, 2018
This is version 119 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health