SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9CQC8

- SPG21_MOUSE

UniProt

Q9CQC8 - SPG21_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Maspardin

Gene
Spg21
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role as a negative regulatory factor in CD4-dependent T-cell activation By similarity.

GO - Molecular functioni

  1. CD4 receptor binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Maspardin
Alternative name(s):
Acid cluster protein 33
Spastic paraplegia 21 autosomal recessive Mast syndrome protein homolog
Gene namesi
Name:Spg21
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 9

Organism-specific databases

MGIiMGI:106403. Spg21.

Subcellular locationi

Cytoplasm By similarity

GO - Cellular componenti

  1. cytosol Source: UniProtKB
  2. nucleus Source: Ensembl
  3. trans-Golgi network transport vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 308308MaspardinPRO_0000227982Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei304 – 3041Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9CQC8.
PaxDbiQ9CQC8.
PRIDEiQ9CQC8.

PTM databases

PhosphoSiteiQ9CQC8.

Expressioni

Tissue specificityi

Expressed in cell lines FT.1 and in a L cell fibroblast derivative (at protein level).1 Publication

Gene expression databases

ArrayExpressiQ9CQC8.
BgeeiQ9CQC8.
CleanExiMM_SPG21.
GenevestigatoriQ9CQC8.

Interactioni

Subunit structurei

Interacts with CD4 By similarity. Interacts with ALDH16A1 By similarity.

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034955.

Structurei

3D structure databases

ProteinModelPortaliQ9CQC8.

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily.

Phylogenomic databases

eggNOGiNOG77636.
GeneTreeiENSGT00390000007857.
HOGENOMiHOG000236323.
HOVERGENiHBG080704.
InParanoidiQ9CQC8.
OMAiSLQYPVY.
OrthoDBiEOG7F5120.
PhylomeDBiQ9CQC8.
TreeFamiTF105253.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR026151. Maspardin.
[Graphical view]
PANTHERiPTHR15913. PTHR15913. 1 hit.
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9CQC8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGEIKVSPDY NWFRSTVPLK KIIVDDDDSK IWSLYDAGPR SIRCPLIFLP    50
PVSGTADVFF QQILALTGWG YRVIALQYPV YWDHLEFCDG FRKLLDHLQL 100
DKVHLFGASL GGFLAQKFAE YTHKSPRVHS LILCNAFSDT SIFNQTWTAN 150
SFWLMPAFML KKIVLGNFSS GPVDPMMADA IDFMVDRLES LGQSELASRL 200
TLNCQNSYVE PHKIRDIPVT IMDVFDQSAL STEAKEEMYK LYPNARRAHL 250
KTGGNFPYLC RSAEVNLYVQ IHLLQFHGTK YAAIDPSVVS AEELEVQKGR 300
LGLSQEEP 308
Length:308
Mass (Da):34,952
Last modified:June 1, 2001 - v1
Checksum:i9E312FCB0865CBB5
GO
Isoform 2 (identifier: Q9CQC8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     271-308: IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP → VSPAWTPEHVRFRDPPQDSAP

Note: No experimental confirmation available.

Show »
Length:291
Mass (Da):33,151
Checksum:i8CB2A030E571760B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei271 – 30838IHLLQ…SQEEP → VSPAWTPEHVRFRDPPQDSA P in isoform 2. VSP_017634Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti278 – 2781G → V in BAE29174. 1 Publication
Sequence conflicti292 – 2921E → G in BAE31867. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK009332 mRNA. Translation: BAB26224.1.
AK011985 mRNA. Translation: BAB27958.1.
AK090017 mRNA. Translation: BAC41047.1.
AK149930 mRNA. Translation: BAE29174.1.
AK150215 mRNA. Translation: BAE29385.1.
AK150581 mRNA. Translation: BAE29675.1.
AK153284 mRNA. Translation: BAE31867.1.
AK170666 mRNA. Translation: BAE41947.1.
BC099434 mRNA. Translation: AAH99434.1.
CCDSiCCDS23293.1. [Q9CQC8-1]
RefSeqiNP_613050.1. NM_138584.2. [Q9CQC8-1]
XP_006511285.1. XM_006511222.1. [Q9CQC8-1]
UniGeneiMm.272475.

Genome annotation databases

EnsembliENSMUST00000034955; ENSMUSP00000034955; ENSMUSG00000032388. [Q9CQC8-1]
GeneIDi27965.
KEGGimmu:27965.
UCSCiuc009qdi.1. mouse. [Q9CQC8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK009332 mRNA. Translation: BAB26224.1 .
AK011985 mRNA. Translation: BAB27958.1 .
AK090017 mRNA. Translation: BAC41047.1 .
AK149930 mRNA. Translation: BAE29174.1 .
AK150215 mRNA. Translation: BAE29385.1 .
AK150581 mRNA. Translation: BAE29675.1 .
AK153284 mRNA. Translation: BAE31867.1 .
AK170666 mRNA. Translation: BAE41947.1 .
BC099434 mRNA. Translation: AAH99434.1 .
CCDSi CCDS23293.1. [Q9CQC8-1 ]
RefSeqi NP_613050.1. NM_138584.2. [Q9CQC8-1 ]
XP_006511285.1. XM_006511222.1. [Q9CQC8-1 ]
UniGenei Mm.272475.

3D structure databases

ProteinModelPortali Q9CQC8.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000034955.

PTM databases

PhosphoSitei Q9CQC8.

Proteomic databases

MaxQBi Q9CQC8.
PaxDbi Q9CQC8.
PRIDEi Q9CQC8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000034955 ; ENSMUSP00000034955 ; ENSMUSG00000032388 . [Q9CQC8-1 ]
GeneIDi 27965.
KEGGi mmu:27965.
UCSCi uc009qdi.1. mouse. [Q9CQC8-1 ]

Organism-specific databases

CTDi 51324.
MGIi MGI:106403. Spg21.

Phylogenomic databases

eggNOGi NOG77636.
GeneTreei ENSGT00390000007857.
HOGENOMi HOG000236323.
HOVERGENi HBG080704.
InParanoidi Q9CQC8.
OMAi SLQYPVY.
OrthoDBi EOG7F5120.
PhylomeDBi Q9CQC8.
TreeFami TF105253.

Miscellaneous databases

NextBioi 306452.
PROi Q9CQC8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9CQC8.
Bgeei Q9CQC8.
CleanExi MM_SPG21.
Genevestigatori Q9CQC8.

Family and domain databases

Gene3Di 3.40.50.1820. 1 hit.
InterProi IPR029058. AB_hydrolase.
IPR026151. Maspardin.
[Graphical view ]
PANTHERi PTHR15913. PTHR15913. 1 hit.
SUPFAMi SSF53474. SSF53474. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow, Dendritic cell, Embryo and Tongue.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  3. "Cloning of ACP33 as a novel intracellular ligand of CD4."
    Zeitlmann L., Sirim P., Kremmer E., Kolanus W.
    J. Biol. Chem. 276:9123-9132(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiSPG21_MOUSE
AccessioniPrimary (citable) accession number: Q9CQC8
Secondary accession number(s): Q3U658, Q3UDT7, Q8C1Y7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi