Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and SOCS box protein 11

Gene

Asb11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 11
Short name:
ASB-11
Gene namesi
Name:Asb11
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1916104. Asb11.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 323323Ankyrin repeat and SOCS box protein 11PRO_0000066945Add
BLAST

Proteomic databases

PaxDbiQ9CQ31.
PRIDEiQ9CQ31.

PTM databases

iPTMnetiQ9CQ31.

Expressioni

Gene expression databases

BgeeiQ9CQ31.
CleanExiMM_ASB11.
GenevisibleiQ9CQ31. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033755.

Structurei

3D structure databases

ProteinModelPortaliQ9CQ31.
SMRiQ9CQ31. Positions 2-322.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati64 – 9330ANK 1Add
BLAST
Repeati97 – 12630ANK 2Add
BLAST
Repeati130 – 15930ANK 3Add
BLAST
Repeati162 – 19130ANK 4Add
BLAST
Repeati195 – 22430ANK 5Add
BLAST
Repeati227 – 25630ANK 6Add
BLAST
Repeati260 – 28930ANK 7Add
BLAST
Domaini273 – 32351SOCS boxPROSITE-ProRule annotationAdd
BLAST

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

Sequence similaritiesi

Belongs to the ankyrin SOCS box (ASB) family.Curated
Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 SOCS box domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00730000110500.
HOGENOMiHOG000231513.
HOVERGENiHBG001376.
InParanoidiQ9CQ31.
KOiK10333.
OMAiRACHQTI.
OrthoDBiEOG7J447G.
PhylomeDBiQ9CQ31.
TreeFamiTF331945.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_box.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 2 hits.
PF07525. SOCS_box. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
PS50225. SOCS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CQ31-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDAPAFYGF KNIFLTMFAT FFFFKLLIKV FLALLTHFYI VKGNRKEAAR
60 70 80 90 100
IAEEIYGGLS DCWADRSPLH EAAAQGRLLA LKTLIAQGIN VNLVTINRVS
110 120 130 140 150
SLHEACLGGH VACAKALLEN GAHVNAQTVH GATPLFNACC SGSAACVNVL
160 170 180 190 200
LEFGAKAQLE IYLASPIHEA VKRGHRECME ILLTKDVNIE QEVPQLGTPL
210 220 230 240 250
YVACTYQRVD CVKKLLELGA SVDHGQWLDT PLHAAVRQSS VEVINLLTVY
260 270 280 290 300
GANLNLRNAQ GKSALDLAVP KSSVRQALLL HEGPPALSQL CRLCVRKCLG
310 320
RTCHHAIYAL GLPESLEKFL LYQ
Length:323
Mass (Da):35,331
Last modified:June 1, 2001 - v1
Checksum:iD1C0603CB7DBBB00
GO
Isoform 2 (identifier: Q9CQ31-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MEDAPAFYGF...IAEEIYGGLS → MLQLAGEEGVRRPGPWKEISFGDYICHTFQG

Show »
Length:294
Mass (Da):31,893
Checksum:i44C121B032578537
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6060MEDAP…YGGLS → MLQLAGEEGVRRPGPWKEIS FGDYICHTFQG in isoform 2. 1 PublicationVSP_013946Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398972 mRNA. Translation: AAK97494.1.
AK002412 mRNA. Translation: BAB22080.1.
AK004396 mRNA. Translation: BAB23286.1.
AK005404 mRNA. Translation: BAB24004.1.
AK146664 mRNA. Translation: BAE27342.1.
AL732475 Genomic DNA. Translation: CAM17374.1.
BC064047 mRNA. Translation: AAH64047.1.
CCDSiCCDS30523.1. [Q9CQ31-2]
RefSeqiNP_001300666.1. NM_001313737.1. [Q9CQ31-1]
NP_081129.1. NM_026853.2. [Q9CQ31-2]
UniGeneiMm.33225.

Genome annotation databases

EnsembliENSMUST00000033755; ENSMUSP00000033755; ENSMUSG00000031382. [Q9CQ31-2]
ENSMUST00000036858; ENSMUSP00000044637; ENSMUSG00000031382. [Q9CQ31-1]
GeneIDi68854.
KEGGimmu:68854.
UCSCiuc009uvq.1. mouse. [Q9CQ31-1]
uc009uvr.1. mouse. [Q9CQ31-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398972 mRNA. Translation: AAK97494.1.
AK002412 mRNA. Translation: BAB22080.1.
AK004396 mRNA. Translation: BAB23286.1.
AK005404 mRNA. Translation: BAB24004.1.
AK146664 mRNA. Translation: BAE27342.1.
AL732475 Genomic DNA. Translation: CAM17374.1.
BC064047 mRNA. Translation: AAH64047.1.
CCDSiCCDS30523.1. [Q9CQ31-2]
RefSeqiNP_001300666.1. NM_001313737.1. [Q9CQ31-1]
NP_081129.1. NM_026853.2. [Q9CQ31-2]
UniGeneiMm.33225.

3D structure databases

ProteinModelPortaliQ9CQ31.
SMRiQ9CQ31. Positions 2-322.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033755.

PTM databases

iPTMnetiQ9CQ31.

Proteomic databases

PaxDbiQ9CQ31.
PRIDEiQ9CQ31.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033755; ENSMUSP00000033755; ENSMUSG00000031382. [Q9CQ31-2]
ENSMUST00000036858; ENSMUSP00000044637; ENSMUSG00000031382. [Q9CQ31-1]
GeneIDi68854.
KEGGimmu:68854.
UCSCiuc009uvq.1. mouse. [Q9CQ31-1]
uc009uvr.1. mouse. [Q9CQ31-2]

Organism-specific databases

CTDi140456.
MGIiMGI:1916104. Asb11.

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00730000110500.
HOGENOMiHOG000231513.
HOVERGENiHBG001376.
InParanoidiQ9CQ31.
KOiK10333.
OMAiRACHQTI.
OrthoDBiEOG7J447G.
PhylomeDBiQ9CQ31.
TreeFamiTF331945.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

PROiQ9CQ31.
SOURCEiSearch...

Gene expression databases

BgeeiQ9CQ31.
CleanExiMM_ASB11.
GenevisibleiQ9CQ31. MM.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_box.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 2 hits.
PF07525. SOCS_box. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
PS50225. SOCS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Amnion, Kidney and Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Mammary gland.

Entry informationi

Entry nameiASB11_MOUSE
AccessioniPrimary (citable) accession number: Q9CQ31
Secondary accession number(s): A2AIH7, Q3UJ13, Q9D0V1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 1, 2001
Last modified: June 8, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.