Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Palmitoyltransferase ZDHHC6

Gene

Zdhhc6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins.By similarity

Catalytic activityi

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAcyltransferase, Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
Palmitoyltransferase ZDHHC6 (EC:2.3.1.225)
Alternative name(s):
H4 homolog
Zinc finger DHHC domain-containing protein 6
Short name:
DHHC-6
Gene namesi
Name:Zdhhc6
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:1914230. Zdhhc6.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei25 – 45HelicalSequence analysisAdd BLAST21
Transmembranei58 – 78HelicalSequence analysisAdd BLAST21
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Transmembranei195 – 215HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002128721 – 413Palmitoyltransferase ZDHHC6Add BLAST413

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

EPDiQ9CPV7.
PaxDbiQ9CPV7.
PeptideAtlasiQ9CPV7.
PRIDEiQ9CPV7.

PTM databases

iPTMnetiQ9CPV7.
PhosphoSitePlusiQ9CPV7.
SwissPalmiQ9CPV7.

Expressioni

Gene expression databases

BgeeiENSMUSG00000024982.
CleanExiMM_ZDHHC6.
GenevisibleiQ9CPV7. MM.

Interactioni

Protein-protein interaction databases

BioGridi211853. 8 interactors.
STRINGi10090.ENSMUSP00000076157.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini99 – 149DHHCPROSITE-ProRule annotationAdd BLAST51

Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity

Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1314. Eukaryota.
COG5273. LUCA.
GeneTreeiENSGT00880000137864.
HOGENOMiHOG000017896.
HOVERGENiHBG054221.
InParanoidiQ9CPV7.
KOiK20031.
OMAiFAHQALF.
OrthoDBiEOG091G0HOK.
PhylomeDBiQ9CPV7.
TreeFamiTF320809.

Family and domain databases

InterProiView protein in InterPro
IPR001594. Palmitoyltrfase_DHHC.
IPR011511. SH3_2.
IPR001452. SH3_domain.
PfamiView protein in Pfam
PF01529. DHHC. 1 hit.
PF07653. SH3_2. 1 hit.
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiView protein in PROSITE
PS50216. DHHC. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q9CPV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGIFCSVIKF ENLQDLRRLC HWGPIIALGV IAICSTMAMI DSVLWYWPLH
60 70 80 90 100
TTGGSVNFIM LINWTVMILY NYFNAMFAGP GFVPRGWKPE KSQDSMYLQY
110 120 130 140 150
CKVCQAYKAP RSHHCRKCNR CVMKMDHHCP WINNCCGHQN HASFTLFLLL
160 170 180 190 200
APLGCTHAAF IFVMTMYTQL YNRLSFGWNT VKIDMSAARR DPPPIVPFGL
210 220 230 240 250
AAFAATLFAL GLALGTTIAV GMLFFIQIKI ILRNKTSIES WIEEKAKDRI
260 270 280 290 300
QYYQLDEVFI FPYDMGSKWK NFKQVFTWSG VPEGDGLEWP IREGCDQYSL
310 320 330 340 350
TIEQLKQKAD KRVRSVRYKV IEDYNGACCP LNRGVRTFFT SPCTEEPRIR
360 370 380 390 400
LQKGEFILAT RGLRYWLYGD KILDDSFIEG TSRVRGWFPR NCVEKCPCDG
410
DSDPAPEGEK KNR
Length:413
Mass (Da):47,527
Last modified:June 1, 2001 - v1
Checksum:iF1A491B4F9DDDB4C
GO
Isoform 2 (identifier: Q9CPV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-399: TSRVRGWFPRNCVEKCPCD → SHCVTQPQTCSALALAS
     400-413: Missing.

Show »
Length:397
Mass (Da):45,509
Checksum:iA06069DA5312007E
GO
Isoform 3 (identifier: Q9CPV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     380-413: GTSRVRGWFPRNCVEKCPCDGDSDPAPEGEKKNR → DQDVELSAPSPAPCLPRCCHVSHHDDNGLNL

Show »
Length:410
Mass (Da):47,076
Checksum:i42B055383E81C9F6
GO
Isoform 4 (identifier: Q9CPV7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-413: TSRVRGWFPRNCVEKCPCDGDSDPAPEGEKKNR → VSVEKKKSTIAWNLIAESLALQKKKVSKPKIVFDMEHRGVV

Note: No experimental confirmation available.
Show »
Length:421
Mass (Da):48,429
Checksum:i4349AA1101E78424
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti269W → R in BAC28968 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006941380 – 413GTSRV…EKKNR → DQDVELSAPSPAPCLPRCCH VSHHDDNGLNL in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_016270381 – 413TSRVR…EKKNR → VSVEKKKSTIAWNLIAESLA LQKKKVSKPKIVFDMEHRGV V in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_006939381 – 399TSRVR…KCPCD → SHCVTQPQTCSALALAS in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_006940400 – 413Missing in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK011373 mRNA. Translation: BAB27576.1.
AK010296 mRNA. Translation: BAB26831.1.
AK077693 mRNA. Translation: BAC36960.1.
AK050388 mRNA. Translation: BAC34229.1.
AK035172 mRNA. Translation: BAC28968.1.
AK038177 mRNA. Translation: BAC29944.1.
AK077838 mRNA. Translation: BAC37027.1.
AK139707 mRNA. Translation: BAE24110.1.
AK144128 mRNA. Translation: BAE25717.1.
AK154741 mRNA. Translation: BAE32798.1.
AK157494 mRNA. Translation: BAE34103.1.
AK159304 mRNA. Translation: BAE34974.1.
BC033317 mRNA. Translation: AAH33317.1.
CCDSiCCDS29909.1. [Q9CPV7-1]
RefSeqiNP_001028745.1. NM_001033573.1. [Q9CPV7-1]
NP_080159.3. NM_025883.3. [Q9CPV7-1]
XP_006527331.1. XM_006527268.2. [Q9CPV7-1]
XP_011245618.1. XM_011247316.1. [Q9CPV7-1]
UniGeneiMm.386789.

Genome annotation databases

EnsembliENSMUST00000076891; ENSMUSP00000076157; ENSMUSG00000024982. [Q9CPV7-1]
GeneIDi66980.
KEGGimmu:66980.
UCSCiuc008hxs.2. mouse. [Q9CPV7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiZDHC6_MOUSE
AccessioniPrimary (citable) accession number: Q9CPV7
Secondary accession number(s): Q3U3I8, Q3UT70, Q544H1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2003
Last sequence update: June 1, 2001
Last modified: June 7, 2017
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families