Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glyoxalase domain-containing protein 4

Gene

Glod4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Glyoxalase domain-containing protein 4
Gene namesi
Name:Glod4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1914451. Glod4.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: MGI
  • mitochondrion Source: MGI

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002803921 – 298Glyoxalase domain-containing protein 4Add BLAST298

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei109N6-succinyllysineCombined sources1
Modified residuei131PhosphoserineCombined sources1
Modified residuei273N6-succinyllysineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9CPV4.
PaxDbiQ9CPV4.
PeptideAtlasiQ9CPV4.
PRIDEiQ9CPV4.

2D gel databases

REPRODUCTION-2DPAGEiQ9CPV4.

PTM databases

iPTMnetiQ9CPV4.
PhosphoSitePlusiQ9CPV4.

Expressioni

Gene expression databases

BgeeiENSMUSG00000017286.
CleanExiMM_GLOD4.
ExpressionAtlasiQ9CPV4. baseline and differential.
GenevisibleiQ9CPV4. MM.

Interactioni

Subunit structurei

Interacts with NUDT9.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ9CPV4. 4 interactors.
MINTiMINT-4125861.
STRINGi10090.ENSMUSP00000017430.

Structurei

3D structure databases

ProteinModelPortaliQ9CPV4.
SMRiQ9CPV4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 130VOC 1PROSITE-ProRule annotationAdd BLAST126
Domaini137 – 258VOC 2PROSITE-ProRule annotationAdd BLAST122

Sequence similaritiesi

Belongs to the glyoxalase I family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IRT7. Eukaryota.
ENOG410XP3J. LUCA.
GeneTreeiENSGT00390000012340.
HOGENOMiHOG000006776.
HOVERGENiHBG056038.
InParanoidiQ9CPV4.
OMAiCEAACNG.
OrthoDBiEOG091G0EHY.
PhylomeDBiQ9CPV4.
TreeFamiTF105801.

Family and domain databases

Gene3Di3.10.180.10. 2 hits.
InterProiView protein in InterPro
IPR029068. Glyas_Bleomycin-R_OHBP_Dase.
SUPFAMiSSF54593. SSF54593. 1 hit.
PROSITEiView protein in PROSITE
PS51819. VOC. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CPV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATRRALHFV FKVKNRFQTV HFFRDVLGMQ VLRHEEFEEG CKAACNGPYD
60 70 80 90 100
GKWSKTMVGF GPEDDHFVAE LTYNYGIGDY KLGNDFMGIT LASSQAVSNA
110 120 130 140 150
RKLEWPLSKV AEGIFETEAP GGYKFYLQDR SPSQSDPVLK VTLAVSDLQK
160 170 180 190 200
SLNYWSNLLG MKIYEQDEEK QRALLGYADN QCKLELQGIQ GAVDHAAAFG
210 220 230 240 250
RIAFSCPQKE LPDLEDLMKR ESHSILTPLV SLDTPGKATV QVVILADPDG
260 270 280 290
HEICFVGDEA FRELSKMDPK GSKLLDDAME ADKSDEWFAT RNKPKASG
Length:298
Mass (Da):33,317
Last modified:June 1, 2001 - v1
Checksum:iF2CD5FD2387A78CE
GO
Isoform 2 (identifier: Q9CPV4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     278-291: AMEADKSDEWFATR → GEGCTDRVRTANPG
     292-298: Missing.

Show »
Length:291
Mass (Da):32,410
Checksum:i7B6307C470BEBD74
GO
Isoform 3 (identifier: Q9CPV4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MATRRALHFVFKVKNRFQTVHFFRDVLGMQ → MICGSVLNSPD

Show »
Length:279
Mass (Da):30,771
Checksum:i974664AC560AB451
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti46N → Y in BAB27311 (PubMed:16141072).Curated1
Sequence conflicti84N → K in BAB24818 (PubMed:16141072).Curated1
Sequence conflicti214L → I in BAB27311 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0236491 – 30MATRR…VLGMQ → MICGSVLNSPD in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_023650278 – 291AMEAD…WFATR → GEGCTDRVRTANPG in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_023651292 – 298Missing in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006979 mRNA. Translation: BAB24818.1.
AK010992 mRNA. Translation: BAB27311.1.
AK012569 mRNA. Translation: BAB28324.1.
AK013212 mRNA. Translation: BAB28716.1.
AK138073 mRNA. Translation: BAE23546.1.
AL591129 Genomic DNA. Translation: CAI35102.1.
BC061012 mRNA. Translation: AAH61012.1.
CCDSiCCDS25063.1. [Q9CPV4-1]
RefSeqiNP_080305.2. NM_026029.3. [Q9CPV4-1]
XP_006534033.1. XM_006533970.3. [Q9CPV4-3]
UniGeneiMm.482113.

Genome annotation databases

EnsembliENSMUST00000017430; ENSMUSP00000017430; ENSMUSG00000017286. [Q9CPV4-1]
ENSMUST00000170710; ENSMUSP00000131788; ENSMUSG00000017286. [Q9CPV4-3]
GeneIDi67201.
KEGGimmu:67201.
UCSCiuc007kfc.2. mouse. [Q9CPV4-2]
uc007kfl.2. mouse. [Q9CPV4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006979 mRNA. Translation: BAB24818.1.
AK010992 mRNA. Translation: BAB27311.1.
AK012569 mRNA. Translation: BAB28324.1.
AK013212 mRNA. Translation: BAB28716.1.
AK138073 mRNA. Translation: BAE23546.1.
AL591129 Genomic DNA. Translation: CAI35102.1.
BC061012 mRNA. Translation: AAH61012.1.
CCDSiCCDS25063.1. [Q9CPV4-1]
RefSeqiNP_080305.2. NM_026029.3. [Q9CPV4-1]
XP_006534033.1. XM_006533970.3. [Q9CPV4-3]
UniGeneiMm.482113.

3D structure databases

ProteinModelPortaliQ9CPV4.
SMRiQ9CPV4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9CPV4. 4 interactors.
MINTiMINT-4125861.
STRINGi10090.ENSMUSP00000017430.

PTM databases

iPTMnetiQ9CPV4.
PhosphoSitePlusiQ9CPV4.

2D gel databases

REPRODUCTION-2DPAGEiQ9CPV4.

Proteomic databases

EPDiQ9CPV4.
PaxDbiQ9CPV4.
PeptideAtlasiQ9CPV4.
PRIDEiQ9CPV4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000017430; ENSMUSP00000017430; ENSMUSG00000017286. [Q9CPV4-1]
ENSMUST00000170710; ENSMUSP00000131788; ENSMUSG00000017286. [Q9CPV4-3]
GeneIDi67201.
KEGGimmu:67201.
UCSCiuc007kfc.2. mouse. [Q9CPV4-2]
uc007kfl.2. mouse. [Q9CPV4-1]

Organism-specific databases

CTDi51031.
MGIiMGI:1914451. Glod4.

Phylogenomic databases

eggNOGiENOG410IRT7. Eukaryota.
ENOG410XP3J. LUCA.
GeneTreeiENSGT00390000012340.
HOGENOMiHOG000006776.
HOVERGENiHBG056038.
InParanoidiQ9CPV4.
OMAiCEAACNG.
OrthoDBiEOG091G0EHY.
PhylomeDBiQ9CPV4.
TreeFamiTF105801.

Miscellaneous databases

PROiPR:Q9CPV4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000017286.
CleanExiMM_GLOD4.
ExpressionAtlasiQ9CPV4. baseline and differential.
GenevisibleiQ9CPV4. MM.

Family and domain databases

Gene3Di3.10.180.10. 2 hits.
InterProiView protein in InterPro
IPR029068. Glyas_Bleomycin-R_OHBP_Dase.
SUPFAMiSSF54593. SSF54593. 1 hit.
PROSITEiView protein in PROSITE
PS51819. VOC. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiGLOD4_MOUSE
AccessioniPrimary (citable) accession number: Q9CPV4
Secondary accession number(s): Q3UUS8, Q9CY26, Q9D9F5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: June 1, 2001
Last modified: June 7, 2017
This is version 119 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.