Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9C927

- PPA5_ARATH

UniProt

Q9C927 - PPA5_ARATH

Protein

Purple acid phosphatase 5

Gene

PAP5

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    A phosphate monoester + H2O = an alcohol + phosphate.

    Cofactori

    Binds 1 iron ion per subunit.By similarity
    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi125 – 1251IronBy similarity
    Metal bindingi153 – 1531IronBy similarity
    Metal bindingi153 – 1531ZincBy similarity
    Metal bindingi156 – 1561IronBy similarity
    Metal bindingi190 – 1901ZincBy similarity
    Binding sitei190 – 1901SubstrateBy similarity
    Metal bindingi250 – 2501ZincBy similarity
    Active sitei260 – 2601Proton donorBy similarity
    Metal bindingi287 – 2871ZincBy similarity
    Metal bindingi289 – 2891IronBy similarity

    GO - Molecular functioni

    1. acid phosphatase activity Source: TAIR
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. dephosphorylation Source: GOC

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Iron, Metal-binding, Zinc

    Enzyme and pathway databases

    BioCyciARA:AT1G52940-MONOMER.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Purple acid phosphatase 5 (EC:3.1.3.2)
    Gene namesi
    Name:PAP5
    Synonyms:AT9
    Ordered Locus Names:At1g52940
    ORF Names:F14G24.21
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 1

    Organism-specific databases

    TAIRiAT1G52940.

    Subcellular locationi

    Secreted By similarity

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1313Sequence AnalysisAdd
    BLAST
    Chaini14 – 396383Purple acid phosphatase 5PRO_0000372810Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi133 – 1331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi238 – 2381N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi303 – 3031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi360 – 3601N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9C927.
    PRIDEiQ9C927.

    Expressioni

    Gene expression databases

    GenevestigatoriQ9C927.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ9C927.
    SMRiQ9C927. Positions 4-389.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni287 – 2893Substrate bindingBy similarity

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiCOG1409.
    HOGENOMiHOG000238330.
    InParanoidiQ9C927.
    OMAiHEIDYAQ.
    PhylomeDBiQ9C927.

    Family and domain databases

    Gene3Di2.60.40.380. 1 hit.
    3.60.21.10. 1 hit.
    InterProiIPR004843. Calcineurin-like_PHP_apaH.
    IPR029052. Metallo-depent_PP-like.
    IPR008963. Purple_acid_Pase-like_N.
    IPR015914. Purple_acid_Pase_N.
    IPR025733. Purple_acid_PPase_C_dom.
    [Graphical view]
    PfamiPF00149. Metallophos. 1 hit.
    PF14008. Metallophos_C. 1 hit.
    [Graphical view]
    SUPFAMiSSF49363. SSF49363. 1 hit.
    SSF56300. SSF56300. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9C927-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSLETFPPPA GYNAPEQVHI TQGDHNGRGM IISWVTSLNE DGSNVVTYWI    50
    ASSDGSDNKS VIATTSSYRY FDYTSGYLHH AIIKELEYKT KYFYELGTGR 100
    STRQFNLTPP KVGPDVPYTF GVIGDLGQTY ASNQTLYNYM SNPKGQAVLF 150
    AGDLSYADDH PNHDQSKWDS YGRFVEPSAA YQPWIWAAGN HEIDYAQSIG 200
    ETQPFKPYKN RYHVPYRASQ NKYTPQNSWL QDEFKKVNRS ETPWLIVLVH 250
    APWYNSNNYH YMEGESMRVT FEPWFVENKV DIVFAGHVHA YERSERVSNI 300
    QYNITDGMST PVKDQNAPVY ITIGDGGNIE GIANIFTDPQ PSYSAFREAS 350
    FGHALLEIKN RTHAHYTWHR NKEDEAVIAD SIWLKNRYYL PEEETI 396

    Note: Derived from EST data. No experimental confirmation available.

    Length:396
    Mass (Da):45,420
    Last modified:June 1, 2001 - v1
    Checksum:i52296BA227053E84
    GO
    Isoform 2 (identifier: Q9C927-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         221-251: NKYTPQNSWLQDEFKKVNRSETPWLIVLVHA → STSPLWYSIKRASAYIIILSSL

    Show »
    Length:387
    Mass (Da):44,148
    Checksum:i086ED8BE5ACD7A42
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei221 – 25131NKYTP…VLVHA → STSPLWYSIKRASAYIIILS SL in isoform 2. 2 PublicationsVSP_037189Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC019018 Genomic DNA. Translation: AAG52275.1.
    CP002684 Genomic DNA. Translation: AEE32870.1.
    DQ459170 mRNA. Translation: ABE97169.1.
    DQ874389 mRNA. Translation: ABI49506.1.
    RefSeqiNP_564619.1. NM_104172.2. [Q9C927-1]
    UniGeneiAt.37498.

    Genome annotation databases

    EnsemblPlantsiAT1G52940.1; AT1G52940.1; AT1G52940. [Q9C927-1]
    GeneIDi841727.
    KEGGiath:AT1G52940.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC019018 Genomic DNA. Translation: AAG52275.1 .
    CP002684 Genomic DNA. Translation: AEE32870.1 .
    DQ459170 mRNA. Translation: ABE97169.1 .
    DQ874389 mRNA. Translation: ABI49506.1 .
    RefSeqi NP_564619.1. NM_104172.2. [Q9C927-1 ]
    UniGenei At.37498.

    3D structure databases

    ProteinModelPortali Q9C927.
    SMRi Q9C927. Positions 4-389.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q9C927.
    PRIDEi Q9C927.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT1G52940.1 ; AT1G52940.1 ; AT1G52940 . [Q9C927-1 ]
    GeneIDi 841727.
    KEGGi ath:AT1G52940.

    Organism-specific databases

    TAIRi AT1G52940.

    Phylogenomic databases

    eggNOGi COG1409.
    HOGENOMi HOG000238330.
    InParanoidi Q9C927.
    OMAi HEIDYAQ.
    PhylomeDBi Q9C927.

    Enzyme and pathway databases

    BioCyci ARA:AT1G52940-MONOMER.

    Gene expression databases

    Genevestigatori Q9C927.

    Family and domain databases

    Gene3Di 2.60.40.380. 1 hit.
    3.60.21.10. 1 hit.
    InterProi IPR004843. Calcineurin-like_PHP_apaH.
    IPR029052. Metallo-depent_PP-like.
    IPR008963. Purple_acid_Pase-like_N.
    IPR015914. Purple_acid_Pase_N.
    IPR025733. Purple_acid_PPase_C_dom.
    [Graphical view ]
    Pfami PF00149. Metallophos. 1 hit.
    PF14008. Metallophos_C. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49363. SSF49363. 1 hit.
    SSF56300. SSF56300. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
      Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K.
      , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
      Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    2. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    3. Underwood B.A., Xiao Y.-L., Moskal W.A. Jr., Monaghan E.L., Wang W., Redman J.C., Wu H.C., Utterback T., Town C.D.
      Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: cv. Columbia.
    4. "Differential expression of Arabidopsis thaliana acid phosphatases in response to abiotic stresses."
      Lohrasebi T., Malboobi M.A., Samaeian A.
      Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 125-242 (ISOFORM 2).
      Tissue: Root.
    5. "Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation."
      Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D.
      J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: GENE FAMILY, NOMENCLATURE.

    Entry informationi

    Entry nameiPPA5_ARATH
    AccessioniPrimary (citable) accession number: Q9C927
    Secondary accession number(s): Q09LH2, Q1KS91
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 5, 2009
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 82 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3