Q9C927 (PPA5_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 60.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Purple acid phosphatase 5 EC=3.1.3.2 | ||||||||
| Gene names |
| ||||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) | ||||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis |
Protein attributes
| Sequence length | 396 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | A phosphate monoester + H2O = an alcohol + phosphate. |
| Cofactor | Binds 1 iron ion per subunit By similarity. Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Homodimer By similarity. |
| Subcellular location | Secreted By similarity. |
| Sequence similarities | Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Ligand | Iron Metal-binding Zinc |
| Molecular function | Hydrolase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | acid phosphatase activity Inferred from electronic annotation. Source: EC metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9C927-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Derived from EST data. No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9C927-2) The sequence of this isoform differs from the canonical sequence as follows: 221-251: NKYTPQNSWLQDEFKKVNRSETPWLIVLVHA → STSPLWYSIKRASAYIIILSSL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 13 | 13 | Potential | ||||||
| Chain | 14 – 396 | 383 | Purple acid phosphatase 5 | PRO_0000372810 | |||||
Regions | |||||||||
| Region | 287 – 289 | 3 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 260 | 1 | Proton donor By similarity | ||||||
| Metal binding | 125 | 1 | Iron By similarity | ||||||
| Metal binding | 153 | 1 | Iron By similarity | ||||||
| Metal binding | 153 | 1 | Zinc By similarity | ||||||
| Metal binding | 156 | 1 | Iron By similarity | ||||||
| Metal binding | 190 | 1 | Zinc By similarity | ||||||
| Metal binding | 250 | 1 | Zinc By similarity | ||||||
| Metal binding | 287 | 1 | Zinc By similarity | ||||||
| Metal binding | 289 | 1 | Iron By similarity | ||||||
| Binding site | 190 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 133 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 238 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 303 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 360 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 221 – 251 | 31 | NKYTP…VLVHA → STSPLWYSIKRASAYIIILS SL in isoform 2. | VSP_037189 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana." Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. Davis R.W.Nature 408:816-820(2000) [PubMed: 11130712] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [2] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [3] | Underwood B.A., Xiao Y.-L., Moskal W.A. Jr., Monaghan E.L., Wang W., Redman J.C., Wu H.C., Utterback T., Town C.D. Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: cv. Columbia. |
| [4] | "Differential expression of Arabidopsis thaliana acid phosphatases in response to abiotic stresses." Lohrasebi T., Malboobi M.A., Samaeian A. Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 125-242 (ISOFORM 2). Tissue: Root. |
| [5] | "Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation." Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D. J. Biol. Chem. 277:27772-27781(2002) [PubMed: 12021284] [Abstract] Cited for: GENE FAMILY, NOMENCLATURE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC019018 Genomic DNA. Translation: AAG52275.1. CP002684 Genomic DNA. Translation: AEE32870.1. DQ459170 mRNA. Translation: ABE97169.1. DQ874389 mRNA. Translation: ABI49506.1. |
| IPI | IPI00539319. IPI00929936. |
| RefSeq | NP_564619.1. NM_104172.2. |
| UniGene | At.37498. |
3D structure databases | |
| HSSP | HSSP built from PDB template 4KBP based on UniProtKB P80366. |
| ProteinModelPortal | Q9C927. |
| SMR | Q9C927. Positions 3-391. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q9C927. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT1G52940.1; AT1G52940.1; AT1G52940. |
| GeneID | 841727. |
| GenomeReviews | Gene locus AT1G52940 in contig CT485782_GR. |
| KEGG | ath:AT1G52940. |
| NMPDR | fig|3702.1.peg.4786. |
Organism-specific databases | |
| TAIR | At1g52940. |
Phylogenomic databases | |
| eggNOG | KOG1378. |
| GeneTree | EPGT00070000028278. |
| HOGENOM | HBG316723. |
| InParanoid | Q9C927. |
| OMA | HEIDYAQ. |
| PhylomeDB | Q9C927. |
| ProtClustDB | CLSN2683029. |
Gene expression databases | |
| Genevestigator | Q9C927. |
Family and domain databases | |
| InterPro | IPR004843. Metallo_PEstase_dom. IPR008963. Purple_acid_Pase-like_N. IPR015914. Purple_acid_Pase_N. [Graphical view] |
| Gene3D | G3DSA:2.60.40.380. Purple_acid_Pase_N. 1 hit. |
| Pfam | PF00149. Metallophos. 1 hit. [Graphical view] |
| SUPFAM | SSF49363. Purple_Pase_N. 1 hit. |
| ProtoNet | Search... |
Entry information
| Entry name | PPA5_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q9C927 Secondary accession number(s): Q09LH2, Q1KS91 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with