Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9C927

- PPA5_ARATH

UniProt

Q9C927 - PPA5_ARATH

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Purple acid phosphatase 5

Gene

PAP5

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

A phosphate monoester + H2O = an alcohol + phosphate.

Cofactori

Protein has several cofactor binding sites:
  • Fe cationBy similarityNote: Binds 1 Fe cation per subunit.By similarity
  • Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi125 – 1251IronBy similarity
Metal bindingi153 – 1531IronBy similarity
Metal bindingi153 – 1531ZincBy similarity
Metal bindingi156 – 1561IronBy similarity
Metal bindingi190 – 1901ZincBy similarity
Binding sitei190 – 1901SubstrateBy similarity
Metal bindingi250 – 2501ZincBy similarity
Active sitei260 – 2601Proton donorBy similarity
Metal bindingi287 – 2871ZincBy similarity
Metal bindingi289 – 2891IronBy similarity

GO - Molecular functioni

  1. acid phosphatase activity Source: TAIR
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. dephosphorylation Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Iron, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciARA:AT1G52940-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Purple acid phosphatase 5 (EC:3.1.3.2)
Gene namesi
Name:PAP5
Synonyms:AT9
Ordered Locus Names:At1g52940
ORF Names:F14G24.21
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 1

Organism-specific databases

TAIRiAT1G52940.

Subcellular locationi

Secreted By similarity

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1313Sequence AnalysisAdd
BLAST
Chaini14 – 396383Purple acid phosphatase 5PRO_0000372810Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
Glycosylationi133 – 1331N-linked (GlcNAc...)Sequence Analysis
Glycosylationi238 – 2381N-linked (GlcNAc...)Sequence Analysis
Glycosylationi303 – 3031N-linked (GlcNAc...)Sequence Analysis
Glycosylationi360 – 3601N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9C927.
PRIDEiQ9C927.

Expressioni

Gene expression databases

GenevestigatoriQ9C927.

Interactioni

Subunit structurei

Homodimer.By similarity

Structurei

3D structure databases

ProteinModelPortaliQ9C927.
SMRiQ9C927. Positions 4-389.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni287 – 2893Substrate bindingBy similarity

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiCOG1409.
HOGENOMiHOG000238330.
InParanoidiQ9C927.
OMAiHEIDYAQ.
PhylomeDBiQ9C927.

Family and domain databases

Gene3Di2.60.40.380. 1 hit.
3.60.21.10. 1 hit.
InterProiIPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
IPR008963. Purple_acid_Pase-like_N.
IPR015914. Purple_acid_Pase_N.
IPR025733. Purple_acid_PPase_C_dom.
[Graphical view]
PfamiPF00149. Metallophos. 1 hit.
PF14008. Metallophos_C. 1 hit.
[Graphical view]
SUPFAMiSSF49363. SSF49363. 1 hit.
SSF56300. SSF56300. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9C927-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLETFPPPA GYNAPEQVHI TQGDHNGRGM IISWVTSLNE DGSNVVTYWI
60 70 80 90 100
ASSDGSDNKS VIATTSSYRY FDYTSGYLHH AIIKELEYKT KYFYELGTGR
110 120 130 140 150
STRQFNLTPP KVGPDVPYTF GVIGDLGQTY ASNQTLYNYM SNPKGQAVLF
160 170 180 190 200
AGDLSYADDH PNHDQSKWDS YGRFVEPSAA YQPWIWAAGN HEIDYAQSIG
210 220 230 240 250
ETQPFKPYKN RYHVPYRASQ NKYTPQNSWL QDEFKKVNRS ETPWLIVLVH
260 270 280 290 300
APWYNSNNYH YMEGESMRVT FEPWFVENKV DIVFAGHVHA YERSERVSNI
310 320 330 340 350
QYNITDGMST PVKDQNAPVY ITIGDGGNIE GIANIFTDPQ PSYSAFREAS
360 370 380 390
FGHALLEIKN RTHAHYTWHR NKEDEAVIAD SIWLKNRYYL PEEETI

Note: Derived from EST data. No experimental confirmation available.

Length:396
Mass (Da):45,420
Last modified:June 1, 2001 - v1
Checksum:i52296BA227053E84
GO
Isoform 2 (identifier: Q9C927-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-251: NKYTPQNSWLQDEFKKVNRSETPWLIVLVHA → STSPLWYSIKRASAYIIILSSL

Show »
Length:387
Mass (Da):44,148
Checksum:i086ED8BE5ACD7A42
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei221 – 25131NKYTP…VLVHA → STSPLWYSIKRASAYIIILS SL in isoform 2. 2 PublicationsVSP_037189Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC019018 Genomic DNA. Translation: AAG52275.1.
CP002684 Genomic DNA. Translation: AEE32870.1.
DQ459170 mRNA. Translation: ABE97169.1.
DQ874389 mRNA. Translation: ABI49506.1.
RefSeqiNP_564619.1. NM_104172.2. [Q9C927-1]
UniGeneiAt.37498.

Genome annotation databases

EnsemblPlantsiAT1G52940.1; AT1G52940.1; AT1G52940. [Q9C927-1]
GeneIDi841727.
KEGGiath:AT1G52940.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC019018 Genomic DNA. Translation: AAG52275.1 .
CP002684 Genomic DNA. Translation: AEE32870.1 .
DQ459170 mRNA. Translation: ABE97169.1 .
DQ874389 mRNA. Translation: ABI49506.1 .
RefSeqi NP_564619.1. NM_104172.2. [Q9C927-1 ]
UniGenei At.37498.

3D structure databases

ProteinModelPortali Q9C927.
SMRi Q9C927. Positions 4-389.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PaxDbi Q9C927.
PRIDEi Q9C927.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

EnsemblPlantsi AT1G52940.1 ; AT1G52940.1 ; AT1G52940 . [Q9C927-1 ]
GeneIDi 841727.
KEGGi ath:AT1G52940.

Organism-specific databases

TAIRi AT1G52940.

Phylogenomic databases

eggNOGi COG1409.
HOGENOMi HOG000238330.
InParanoidi Q9C927.
OMAi HEIDYAQ.
PhylomeDBi Q9C927.

Enzyme and pathway databases

BioCyci ARA:AT1G52940-MONOMER.

Gene expression databases

Genevestigatori Q9C927.

Family and domain databases

Gene3Di 2.60.40.380. 1 hit.
3.60.21.10. 1 hit.
InterProi IPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
IPR008963. Purple_acid_Pase-like_N.
IPR015914. Purple_acid_Pase_N.
IPR025733. Purple_acid_PPase_C_dom.
[Graphical view ]
Pfami PF00149. Metallophos. 1 hit.
PF14008. Metallophos_C. 1 hit.
[Graphical view ]
SUPFAMi SSF49363. SSF49363. 1 hit.
SSF56300. SSF56300. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
    Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K.
    , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
    Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  2. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  3. Underwood B.A., Xiao Y.-L., Moskal W.A. Jr., Monaghan E.L., Wang W., Redman J.C., Wu H.C., Utterback T., Town C.D.
    Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: cv. Columbia.
  4. "Differential expression of Arabidopsis thaliana acid phosphatases in response to abiotic stresses."
    Lohrasebi T., Malboobi M.A., Samaeian A.
    Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 125-242 (ISOFORM 2).
    Tissue: Root.
  5. "Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation."
    Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D.
    J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE FAMILY, NOMENCLATURE.

Entry informationi

Entry nameiPPA5_ARATH
AccessioniPrimary (citable) accession number: Q9C927
Secondary accession number(s): Q09LH2, Q1KS91
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: June 1, 2001
Last modified: November 26, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3