Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Purple acid phosphatase 5

Gene

PAP5

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

A phosphate monoester + H2O = an alcohol + phosphate.

Cofactori

Protein has several cofactor binding sites:
  • Fe cationBy similarityNote: Binds 1 Fe cation per subunit.By similarity
  • Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi125IronBy similarity1
Metal bindingi153IronBy similarity1
Metal bindingi153ZincBy similarity1
Metal bindingi156IronBy similarity1
Metal bindingi190ZincBy similarity1
Binding sitei190SubstrateBy similarity1
Metal bindingi250ZincBy similarity1
Active sitei260Proton donorBy similarity1
Metal bindingi287ZincBy similarity1
Metal bindingi289IronBy similarity1

GO - Molecular functioni

  • acid phosphatase activity Source: TAIR
  • metal ion binding Source: UniProtKB-KW

Keywordsi

Molecular functionHydrolase
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciARA:AT1G52940-MONOMER

Names & Taxonomyi

Protein namesi
Recommended name:
Purple acid phosphatase 5 (EC:3.1.3.2)
Gene namesi
Name:PAP5
Synonyms:AT9
Ordered Locus Names:At1g52940
ORF Names:F14G24.21
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

AraportiAT1G52940
TAIRilocus:2011501 AT1G52940

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 13Sequence analysisAdd BLAST13
ChainiPRO_000037281014 – 396Purple acid phosphatase 5Add BLAST383

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi133N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi238N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi303N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi360N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9C927
PRIDEiQ9C927

Expressioni

Gene expression databases

ExpressionAtlasiQ9C927 differential
GenevisibleiQ9C927 AT

Interactioni

Subunit structurei

Homodimer.By similarity

Protein-protein interaction databases

STRINGi3702.AT1G52940.1

Structurei

3D structure databases

ProteinModelPortaliQ9C927
SMRiQ9C927
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni287 – 289Substrate bindingBy similarity3

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1378 Eukaryota
COG1409 LUCA
HOGENOMiHOG000238330
InParanoidiQ9C927
KOiK22390
OMAiYVRYTHR
OrthoDBiEOG09360APJ
PhylomeDBiQ9C927

Family and domain databases

Gene3Di2.60.40.380, 1 hit
3.60.21.10, 2 hits
InterProiView protein in InterPro
IPR004843 Calcineurin-like_PHP_ApaH
IPR029052 Metallo-depent_PP-like
IPR008963 Purple_acid_Pase-like_N
IPR015914 Purple_acid_Pase_N
IPR025733 Purple_acid_PPase_C_dom
PfamiView protein in Pfam
PF00149 Metallophos, 1 hit
PF14008 Metallophos_C, 1 hit
PF16656 Pur_ac_phosph_N, 1 hit
SUPFAMiSSF49363 SSF49363, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C927-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLETFPPPA GYNAPEQVHI TQGDHNGRGM IISWVTSLNE DGSNVVTYWI
60 70 80 90 100
ASSDGSDNKS VIATTSSYRY FDYTSGYLHH AIIKELEYKT KYFYELGTGR
110 120 130 140 150
STRQFNLTPP KVGPDVPYTF GVIGDLGQTY ASNQTLYNYM SNPKGQAVLF
160 170 180 190 200
AGDLSYADDH PNHDQSKWDS YGRFVEPSAA YQPWIWAAGN HEIDYAQSIG
210 220 230 240 250
ETQPFKPYKN RYHVPYRASQ NKYTPQNSWL QDEFKKVNRS ETPWLIVLVH
260 270 280 290 300
APWYNSNNYH YMEGESMRVT FEPWFVENKV DIVFAGHVHA YERSERVSNI
310 320 330 340 350
QYNITDGMST PVKDQNAPVY ITIGDGGNIE GIANIFTDPQ PSYSAFREAS
360 370 380 390
FGHALLEIKN RTHAHYTWHR NKEDEAVIAD SIWLKNRYYL PEEETI
Note: Derived from EST data. No experimental confirmation available.
Length:396
Mass (Da):45,420
Last modified:June 1, 2001 - v1
Checksum:i52296BA227053E84
GO
Isoform 2 (identifier: Q9C927-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-251: NKYTPQNSWLQDEFKKVNRSETPWLIVLVHA → STSPLWYSIKRASAYIIILSSL

Show »
Length:387
Mass (Da):44,148
Checksum:i086ED8BE5ACD7A42
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_037189221 – 251NKYTP…VLVHA → STSPLWYSIKRASAYIIILS SL in isoform 2. 2 PublicationsAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC019018 Genomic DNA Translation: AAG52275.1
CP002684 Genomic DNA No translation available.
DQ459170 mRNA Translation: ABE97169.1
DQ874389 mRNA Translation: ABI49506.1
RefSeqiNP_001319211.1, NM_001333566.1
UniGeneiAt.37498

Genome annotation databases

GeneIDi841727
KEGGiath:AT1G52940

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPA5_ARATH
AccessioniPrimary (citable) accession number: Q9C927
Secondary accession number(s): Q09LH2, Q1KS91
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: June 1, 2001
Last modified: May 23, 2018
This is version 107 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health