Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9C927 (PPA5_ARATH) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 81. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Purple acid phosphatase 5

EC=3.1.3.2
Gene names
Name:PAP5
Synonyms:AT9
Ordered Locus Names:At1g52940
ORF Names:F14G24.21
OrganismArabidopsis thaliana (Mouse-ear cress) [Reference proteome]
Taxonomic identifier3702 [NCBI]
Taxonomic lineageEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis

Protein attributes

Sequence length396 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

A phosphate monoester + H2O = an alcohol + phosphate.

Cofactor

Binds 1 iron ion per subunit By similarity.

Binds 1 zinc ion per subunit By similarity.

Subunit structure

Homodimer By similarity.

Subcellular location

Secreted By similarity.

Sequence similarities

Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.

Ontologies

Keywords
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   LigandIron
Metal-binding
Zinc
   Molecular functionHydrolase
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processdephosphorylation

Inferred from sequence or structural similarity PubMed 16244908. Source: GOC

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionacid phosphatase activity

Inferred from sequence or structural similarity PubMed 16244908. Source: TAIR

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9C927-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Derived from EST data. No experimental confirmation available.
Isoform 2 (identifier: Q9C927-2)

The sequence of this isoform differs from the canonical sequence as follows:
     221-251: NKYTPQNSWLQDEFKKVNRSETPWLIVLVHA → STSPLWYSIKRASAYIIILSSL

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1313 Potential
Chain14 – 396383Purple acid phosphatase 5
PRO_0000372810

Regions

Region287 – 2893Substrate binding By similarity

Sites

Active site2601Proton donor By similarity
Metal binding1251Iron By similarity
Metal binding1531Iron By similarity
Metal binding1531Zinc By similarity
Metal binding1561Iron By similarity
Metal binding1901Zinc By similarity
Metal binding2501Zinc By similarity
Metal binding2871Zinc By similarity
Metal binding2891Iron By similarity
Binding site1901Substrate By similarity

Amino acid modifications

Glycosylation581N-linked (GlcNAc...) Potential
Glycosylation1331N-linked (GlcNAc...) Potential
Glycosylation2381N-linked (GlcNAc...) Potential
Glycosylation3031N-linked (GlcNAc...) Potential
Glycosylation3601N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence221 – 25131NKYTP…VLVHA → STSPLWYSIKRASAYIIILS SL in isoform 2.
VSP_037189

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 52296BA227053E84

FASTA39645,420
        10         20         30         40         50         60 
MSLETFPPPA GYNAPEQVHI TQGDHNGRGM IISWVTSLNE DGSNVVTYWI ASSDGSDNKS 

        70         80         90        100        110        120 
VIATTSSYRY FDYTSGYLHH AIIKELEYKT KYFYELGTGR STRQFNLTPP KVGPDVPYTF 

       130        140        150        160        170        180 
GVIGDLGQTY ASNQTLYNYM SNPKGQAVLF AGDLSYADDH PNHDQSKWDS YGRFVEPSAA 

       190        200        210        220        230        240 
YQPWIWAAGN HEIDYAQSIG ETQPFKPYKN RYHVPYRASQ NKYTPQNSWL QDEFKKVNRS 

       250        260        270        280        290        300 
ETPWLIVLVH APWYNSNNYH YMEGESMRVT FEPWFVENKV DIVFAGHVHA YERSERVSNI 

       310        320        330        340        350        360 
QYNITDGMST PVKDQNAPVY ITIGDGGNIE GIANIFTDPQ PSYSAFREAS FGHALLEIKN 

       370        380        390 
RTHAHYTWHR NKEDEAVIAD SIWLKNRYYL PEEETI 

« Hide

Isoform 2 [UniParc].

Checksum: 086ED8BE5ACD7A42
Show »

FASTA38744,148

References

« Hide 'large scale' references
[1]"Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana."
Theologis A., Ecker J.R., Palm C.J., Federspiel N.A., Kaul S., White O., Alonso J., Altafi H., Araujo R., Bowman C.L., Brooks S.Y., Buehler E., Chan A., Chao Q., Chen H., Cheuk R.F., Chin C.W., Chung M.K. expand/collapse author list , Conn L., Conway A.B., Conway A.R., Creasy T.H., Dewar K., Dunn P., Etgu P., Feldblyum T.V., Feng J.-D., Fong B., Fujii C.Y., Gill J.E., Goldsmith A.D., Haas B., Hansen N.F., Hughes B., Huizar L., Hunter J.L., Jenkins J., Johnson-Hopson C., Khan S., Khaykin E., Kim C.J., Koo H.L., Kremenetskaia I., Kurtz D.B., Kwan A., Lam B., Langin-Hooper S., Lee A., Lee J.M., Lenz C.A., Li J.H., Li Y.-P., Lin X., Liu S.X., Liu Z.A., Luros J.S., Maiti R., Marziali A., Militscher J., Miranda M., Nguyen M., Nierman W.C., Osborne B.I., Pai G., Peterson J., Pham P.K., Rizzo M., Rooney T., Rowley D., Sakano H., Salzberg S.L., Schwartz J.R., Shinn P., Southwick A.M., Sun H., Tallon L.J., Tambunga G., Toriumi M.J., Town C.D., Utterback T., Van Aken S., Vaysberg M., Vysotskaia V.S., Walker M., Wu D., Yu G., Fraser C.M., Venter J.C., Davis R.W.
Nature 408:816-820(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: cv. Columbia.
[2]The Arabidopsis Information Resource (TAIR)
Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
Cited for: GENOME REANNOTATION.
Strain: cv. Columbia.
[3]Underwood B.A., Xiao Y.-L., Moskal W.A. Jr., Monaghan E.L., Wang W., Redman J.C., Wu H.C., Utterback T., Town C.D.
Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: cv. Columbia.
[4]"Differential expression of Arabidopsis thaliana acid phosphatases in response to abiotic stresses."
Lohrasebi T., Malboobi M.A., Samaeian A.
Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 125-242 (ISOFORM 2).
Tissue: Root.
[5]"Purple acid phosphatases of Arabidopsis thaliana. Comparative analysis and differential regulation by phosphate deprivation."
Li D., Zhu H., Liu K., Liu X., Leggewie G., Udvardi M., Wang D.
J. Biol. Chem. 277:27772-27781(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: GENE FAMILY, NOMENCLATURE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC019018 Genomic DNA. Translation: AAG52275.1.
CP002684 Genomic DNA. Translation: AEE32870.1.
DQ459170 mRNA. Translation: ABE97169.1.
DQ874389 mRNA. Translation: ABI49506.1.
RefSeqNP_564619.1. NM_104172.2. [Q9C927-1]
UniGeneAt.37498.

3D structure databases

ProteinModelPortalQ9C927.
SMRQ9C927. Positions 4-389.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ9C927.
PRIDEQ9C927.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsAT1G52940.1; AT1G52940.1; AT1G52940. [Q9C927-1]
GeneID841727.
KEGGath:AT1G52940.

Organism-specific databases

TAIRAT1G52940.

Phylogenomic databases

eggNOGCOG1409.
HOGENOMHOG000238330.
InParanoidQ9C927.
OMAHEIDYAQ.
PhylomeDBQ9C927.

Enzyme and pathway databases

BioCycARA:AT1G52940-MONOMER.

Gene expression databases

GenevestigatorQ9C927.

Family and domain databases

Gene3D2.60.40.380. 1 hit.
3.60.21.10. 1 hit.
InterProIPR004843. Calcineurin-like_PHP_apaH.
IPR029052. Metallo-depent_PP-like.
IPR008963. Purple_acid_Pase-like_N.
IPR015914. Purple_acid_Pase_N.
IPR025733. Purple_acid_PPase_C_dom.
[Graphical view]
PfamPF00149. Metallophos. 1 hit.
PF14008. Metallophos_C. 1 hit.
[Graphical view]
SUPFAMSSF49363. SSF49363. 1 hit.
SSF56300. SSF56300. 1 hit.
ProtoNetSearch...

Entry information

Entry namePPA5_ARATH
AccessionPrimary (citable) accession number: Q9C927
Secondary accession number(s): Q09LH2, Q1KS91
Entry history
Integrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: June 1, 2001
Last modified: June 11, 2014
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Arabidopsis thaliana

Arabidopsis thaliana: entries and gene names