Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chaperonin 60 subunit beta 4, chloroplastic

Gene

CPN60B4

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved specifically in the folding of NDHH, a subunit of the chloroplast NADH dehydrogenase-like complex (NDH).3 Publications

Miscellaneous

CPN60B1, CPN60B2 or CPN60B3 cannot complement the function of CPN60B4.
Assisted protein folding requires ATP hydrolysis, but not K+ ions.

GO - Molecular functioni

GO - Biological processi

  • 'de novo' protein folding Source: GO_Central
  • chaperone-mediated protein folding Source: GO_Central
  • protein folding Source: TAIR
  • protein refolding Source: InterPro

Keywordsi

Molecular functionChaperone
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Chaperonin 60 subunit beta 4, chloroplastic
Short name:
CPN-60 beta 4
Gene namesi
Name:CPN60B4
Synonyms:Cpn60-B(4)
Ordered Locus Names:At1g26230
ORF Names:F28B23.11
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 1

Organism-specific databases

AraportiAT1G26230.
TAIRilocus:2028751. AT1G26230.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Plastid

Pathology & Biotechi

Disruption phenotypei

No visible phenotype besides impaired NDH activity.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 37ChloroplastSequence analysisAdd BLAST37
ChainiPRO_000041368638 – 611Chaperonin 60 subunit beta 4, chloroplasticAdd BLAST574

Proteomic databases

PaxDbiQ9C667.
PRIDEiQ9C667.

Expressioni

Inductioni

Up-regulated by light.1 Publication

Gene expression databases

ExpressionAtlasiQ9C667. baseline and differential.
GenevisibleiQ9C667. AT.

Interactioni

Subunit structurei

Part of the Cpn60 complex composed of 7 alpha and 7 beta subunits. Can also form a complex composed of 14 beta subunits only. Both complexes show ATPase activity. The Cpn60 complex interacts with the Cpn10 complex. Interacts with NDHH.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi24401. 1 interactor.
STRINGi3702.AT1G26230.1.

Structurei

3D structure databases

ProteinModelPortaliQ9C667.
SMRiQ9C667.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili377 – 480Sequence analysisAdd BLAST104

Domaini

The C-terminus (568-611) is required for efficient NDHH folding, but not for the formation of the chaperonin complex.

Sequence similaritiesi

Belongs to the chaperonin (HSP60) family.Curated

Keywords - Domaini

Coiled coil, Transit peptide

Phylogenomic databases

eggNOGiKOG0356. Eukaryota.
COG0459. LUCA.
HOGENOMiHOG000076290.
InParanoidiQ9C667.
KOiK04077.
OMAiKGQIENS.
OrthoDBiEOG093606BL.
PhylomeDBiQ9C667.

Family and domain databases

CDDicd03344. GroEL. 1 hit.
Gene3Di1.10.560.10. 2 hits.
3.50.7.10. 1 hit.
InterProiView protein in InterPro
IPR001844. Chaprnin_Cpn60.
IPR002423. Cpn60/TCP-1.
IPR027409. GroEL-like_apical_dom.
IPR027413. GROEL-like_equatorial.
PfamiView protein in Pfam
PF00118. Cpn60_TCP1. 1 hit.
PRINTSiPR00298. CHAPERONIN60.
SUPFAMiSSF52029. SSF52029. 1 hit.
TIGRFAMsiTIGR02348. GroEL. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C667-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFSQAALSA LPLSDRTFRK KPSSSSSSSP NFVLRVRAAA KEVHFNRDGS
60 70 80 90 100
VTKKLQAGAD MVAKLLGVTL GPKGRNVVLQ NKYGPPRIVN DGETVLKEIE
110 120 130 140 150
LEDPLENVGV KLVRQAGAKT NDLAGDGSTT SIILAHGLIT EGIKVISAGT
160 170 180 190 200
NPIQVARGIE KTTKALVLEL KSMSREIEDH ELAHVAAVSA GNDYEVGNMI
210 220 230 240 250
SNAFQQVGRT GVVTIEKGKY LVNNLEIVEG MQFNRGYLSP YFVTDRRKRE
260 270 280 290 300
AEFHDCKLLL VDKKITNPKD MFKILDSAVK EEFPVLIVAE DIEQDALAPV
310 320 330 340 350
IRNKLKGNLK VAAIKAPAFG ERKSHCLDDL AIFTGATVIR DEMGLSLEKA
360 370 380 390 400
GKEVLGTAKR VLVTKDSTLI VTNGFTQKAV DERVSQIKNL IENTEENFQK
410 420 430 440 450
KILNERVARL SGGIAIIQVG ALTQVELKDK QLKVEDALNA TKSAIEEGIV
460 470 480 490 500
VGGGCALLRL ATKVDRIKET LDNTEQKIGA EIFKKALSYP IRLIAKNADT
510 520 530 540 550
NGNIVIEKVL SNKNTMYGYN AAKNQYEDLM LAGIIDPTKV VRCCLEHASS
560 570 580 590 600
VAQTFLTSDC VVVEIKEIKP RPIINPPLPT SSPATSSMFP DRKLPRFPQI
610
MPRTRSHFPR K
Length:611
Mass (Da):66,796
Last modified:June 1, 2001 - v1
Checksum:iD7CA90E3F5632CBE
GO
Isoform 2 (identifier: Q9C667-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAFSQAALSALPLSDRTFRKKPSSSSSSSPNFVLRVRAAAKEVHFNRDGSVTKKLQ → MVVK

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:559
Mass (Da):61,163
Checksum:iD49526CFC286D28E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti394T → N in BAD95277 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0419571 – 56MAFSQ…TKKLQ → MVVK in isoform 2. CuratedAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC079829 Genomic DNA. Translation: AAG50688.1.
CP002684 Genomic DNA. Translation: AEE30663.1.
CP002684 Genomic DNA. Translation: AEE30664.1.
CP002684 Genomic DNA. Translation: ANM59894.1.
AK221637 mRNA. Translation: BAD95277.1.
PIRiE86388.
RefSeqiNP_001185097.1. NM_001198168.2. [Q9C667-2]
NP_001319083.1. NM_001332699.1.
NP_173947.1. NM_102387.3. [Q9C667-1]
UniGeneiAt.43575.
At.68953.

Genome annotation databases

EnsemblPlantsiAT1G26230.1; AT1G26230.1; AT1G26230. [Q9C667-1]
AT1G26230.4; AT1G26230.4; AT1G26230. [Q9C667-2]
GeneIDi839164.
GrameneiAT1G26230.1; AT1G26230.1; AT1G26230.
AT1G26230.4; AT1G26230.4; AT1G26230.
KEGGiath:AT1G26230.

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCPNB4_ARATH
AccessioniPrimary (citable) accession number: Q9C667
Secondary accession number(s): F4IE47, Q56XN6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2011
Last sequence update: June 1, 2001
Last modified: September 27, 2017
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families