Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptide methionine sulfoxide reductase B2, chloroplastic

Gene

MSRB2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.4 Publications

Miscellaneous

Reduced by thioredoxins f, m, x and y through a dithiol-disulfide exchange involving both redox-active Cys of the two partners.

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (R)-S-oxide + thioredoxin.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Kineticsi

  1. KM=54 µM for dabsyl methionine sulfoxide1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Metal bindingi116ZincPROSITE-ProRule annotation1
    Metal bindingi119ZincPROSITE-ProRule annotation1
    Metal bindingi162ZincPROSITE-ProRule annotation1
    Metal bindingi165ZincPROSITE-ProRule annotation1
    Active sitei187NucleophilePROSITE-ProRule annotation1

    GO - Molecular functioni

    • metal ion binding Source: UniProtKB-KW
    • peptide-methionine (R)-S-oxide reductase activity Source: UniProtKB

    GO - Biological processi

    • protein repair Source: InterPro
    • response to oxidative stress Source: UniProtKB

    Keywordsi

    Molecular functionOxidoreductase
    Biological processElectron transport, Transport
    LigandMetal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Peptide methionine sulfoxide reductase B2, chloroplastic (EC:1.8.4.12)
    Short name:
    AtMSRB2
    Alternative name(s):
    Peptide-methionine (R)-S-oxide reductase
    Gene namesi
    Name:MSRB2
    Ordered Locus Names:At4g21860
    ORF Names:T8O5.70
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    Proteomesi
    • UP000006548 Componenti: Chromosome 4

    Organism-specific databases

    AraportiAT4G21860
    TAIRilocus:2141702 AT4G21860

    Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Chloroplast, Plastid

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Mutagenesisi134C → S or T: Increases activity 2-fold. Abolishes reduction by thioredoxin h. 1 Publication1

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Transit peptidei1 – 63ChloroplastSequence analysisAdd BLAST63
    ChainiPRO_000039552064 – 202Peptide methionine sulfoxide reductase B2, chloroplasticAdd BLAST139

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Disulfide bondi134 ↔ 187Redox-active

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiQ9C5C8
    PRIDEiQ9C5C8

    PTM databases

    iPTMnetiQ9C5C8

    Expressioni

    Tissue specificityi

    Expressed in stems, young leaves, floral buds and flowers. Expressed at low levels in roots, mature leaves and siliques (at protein level).1 Publication

    Inductioni

    By photooxidative stress.1 Publication

    Gene expression databases

    ExpressionAtlasiQ9C5C8 baseline and differential
    GenevisibleiQ9C5C8 AT

    Interactioni

    Protein-protein interaction databases

    BioGridi13563, 1 interactor
    IntActiQ9C5C8, 1 interactor
    STRINGi3702.AT4G21860.1

    Structurei

    3D structure databases

    ProteinModelPortaliQ9C5C8
    SMRiQ9C5C8
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Domaini77 – 198MsrBPROSITE-ProRule annotationAdd BLAST122

    Sequence similaritiesi

    Keywords - Domaini

    Redox-active center, Transit peptide

    Phylogenomic databases

    eggNOGiKOG0856 Eukaryota
    COG0229 LUCA
    HOGENOMiHOG000243424
    InParanoidiQ9C5C8
    KOiK07305
    OMAiMGSHILK
    OrthoDBiEOG09360RTT
    PhylomeDBiQ9C5C8

    Family and domain databases

    InterProiView protein in InterPro
    IPR028427 Met_Sox_Rdtase
    IPR002579 Met_Sox_Rdtase_MsrB
    IPR011057 Mss4-like_sf
    PANTHERiPTHR10173 PTHR10173, 1 hit
    PfamiView protein in Pfam
    PF01641 SelR, 1 hit
    SUPFAMiSSF51316 SSF51316, 1 hit
    TIGRFAMsiTIGR00357 TIGR00357, 1 hit
    PROSITEiView protein in PROSITE
    PS51790 MSRB, 1 hit

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

    Isoform 1 (identifier: Q9C5C8-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

            10         20         30         40         50
    MAFNIITPGR VYSATSLTFV STIKAAFVKP PLASPSRRNL LRFSSSPLSF
    60 70 80 90 100
    PSLRRGFHGG RIVAMGSSAP ESVNKPEEEW RAILSPEQFR ILRQKGTEYP
    110 120 130 140 150
    GTGEYNKVFD DGIYCCAGCG TPLYKSTTKF DSGCGWPAFF DGLPGAITRT
    160 170 180 190 200
    PDPDGRRIEI TCAACGGHLG HVFKGEGFPT PTDERHCVNS ISLKFTPENP

    TL
    Length:202
    Mass (Da):21,968
    Last modified:June 1, 2001 - v1
    Checksum:i53B85798B1E94D68
    GO
    Isoform 2 (identifier: Q9C5C8-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         151-184: PDPDGRRIEITCAACGGHLGHVFKGEGFPTPTDE → MGDESRSHVLLVEDILVTFLKEKVSLLLPMSDTV
         185-202: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:184
    Mass (Da):20,164
    Checksum:i1CFC2A20A3CAEF9A
    GO

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Sequence conflicti31 – 37PLASPSR → SFASRSH in AAM62876 (Ref. 5) Curated7
    Sequence conflicti64A → S in AAM62876 (Ref. 5) Curated1
    Sequence conflicti79E → G in BAH19668 (PubMed:19423640).Curated1
    Sequence conflicti82A → T in AAM62876 (Ref. 5) Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Alternative sequenceiVSP_039510151 – 184PDPDG…TPTDE → MGDESRSHVLLVEDILVTFL KEKVSLLLPMSDTV in isoform 2. 1 PublicationAdd BLAST34
    Alternative sequenceiVSP_039511185 – 202Missing in isoform 2. 1 PublicationAdd BLAST18

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AL021890 Genomic DNA No translation available.
    AL161556 Genomic DNA No translation available.
    CP002687 Genomic DNA Translation: AEE84513.1
    CP002687 Genomic DNA Translation: AEE84514.1
    CP002687 Genomic DNA Translation: AEE84515.1
    CP002687 Genomic DNA Translation: ANM67853.1
    AF360341 mRNA Translation: AAK28638.1
    AY051078 mRNA Translation: AAK93755.1
    AK316971 mRNA Translation: BAH19668.1
    AY085655 mRNA Translation: AAM62876.1
    RefSeqiNP_001078423.1, NM_001084954.2 [Q9C5C8-2]
    NP_001190791.1, NM_001203862.1 [Q9C5C8-1]
    NP_001320026.1, NM_001341518.1 [Q9C5C8-1]
    NP_567639.1, NM_118306.7 [Q9C5C8-1]
    UniGeneiAt.24358

    Genome annotation databases

    EnsemblPlantsiAT4G21860.1; AT4G21860.1; AT4G21860 [Q9C5C8-1]
    AT4G21860.2; AT4G21860.2; AT4G21860 [Q9C5C8-2]
    AT4G21860.3; AT4G21860.3; AT4G21860 [Q9C5C8-1]
    AT4G21860.4; AT4G21860.4; AT4G21860 [Q9C5C8-1]
    GeneIDi828274
    GrameneiAT4G21860.1; AT4G21860.1; AT4G21860 [Q9C5C8-1]
    AT4G21860.2; AT4G21860.2; AT4G21860 [Q9C5C8-2]
    AT4G21860.3; AT4G21860.3; AT4G21860 [Q9C5C8-1]
    AT4G21860.4; AT4G21860.4; AT4G21860 [Q9C5C8-1]
    KEGGiath:AT4G21860

    Keywords - Coding sequence diversityi

    Alternative splicing

    Similar proteinsi

    Entry informationi

    Entry nameiMSRB2_ARATH
    AccessioniPrimary (citable) accession number: Q9C5C8
    Secondary accession number(s): A8MQE9, B9DG01, Q8LE28
    Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 13, 2010
    Last sequence update: June 1, 2001
    Last modified: May 23, 2018
    This is version 111 of the entry and version 1 of the sequence. See complete history.
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. SIMILARITY comments
      Index of protein domains and families

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health