Q9C0H9 (SRCN1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SRC kinase signaling inhibitor 1 Alternative name(s): SNAP-25-interacting protein Short name=SNIP p130Cas-associated protein p140Cap | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1055 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance. Ref.6 Ref.7 Ref.10 |
| Subunit structure | Interacts with the N-terminal coiled-coil region of SNAP25 By similarity. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3. Ref.6 Ref.7 Ref.9 Ref.10 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton. Cell projection › axon By similarity. Cell projection › dendrite By similarity. Cell junction › synapse By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Note: Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions. Ref.6 Ref.10 |
| Tissue specificity | Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue. Ref.8 |
| Post-translational modification | Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands. Ref.6 |
| Sequence similarities | Belongs to the SRCIN1 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCAR1 | P56945 | 3 | EBI-1393949,EBI-702093 | |
| SRC | P12931 | 3 | EBI-1393949,EBI-621482 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9C0H9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9C0H9-2) The sequence of this isoform differs from the canonical sequence as follows: 1012-1055: ATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSISF → V | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9C0H9-4) The sequence of this isoform differs from the canonical sequence as follows: 1-566: Missing. 782-823: AAERDWEEKR...LKAIPDLDCA → VLGPGIVGGA...FFLGGGGPVP 824-1055: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9C0H9-5) The sequence of this isoform differs from the canonical sequence as follows: 1-52: MRGAWVHLHS...SDSEGGVSFA → MGNAPSQDPE...SASQTKLRSP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1055 | 1055 | SRC kinase signaling inhibitor 1 | PRO_0000072011 | |||||
Regions | |||||||||
| Region | 519 – 569 | 51 | Interaction with SNAP25 By similarity | ||||||
| Coiled coil | 433 – 460 | 28 | Potential | ||||||
| Coiled coil | 521 – 546 | 26 | Potential | ||||||
| Coiled coil | 588 – 650 | 63 | Potential | ||||||
| Compositional bias | 343 – 376 | 34 | Pro-rich | ||||||
| Compositional bias | 828 – 886 | 59 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 97 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 113 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 179 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 215 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 234 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 268 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 385 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 394 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 476 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 509 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 738 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 779 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 859 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 915 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 566 | 566 | Missing in isoform 3. | VSP_009366 | |||||
| Alternative sequence | 1 – 52 | 52 | MRGAW…GVSFA → MGNAPSQDPERSSPPMLSAD DAEYPREYRTLGGGGGGGSG GRRFSNVGLVHTSERRHTVI AAQSLEALSGLQKADADRKR DAFMDHLKSKYPQHALALRG QQDRMREQPNYWSFKTRSSR HTQGAQPGLADQAAKLSYAS AESLETMSEAELPLGFSRMN RFRQSLPLSRSASQTKLRSP in isoform 4. | VSP_039240 | |||||
| Alternative sequence | 782 – 823 | 42 | AAERD…DLDCA → VLGPGIVGGAMSQVHTFLRP SFLEWGVPILWVFFLGGGGP VP in isoform 3. | VSP_009367 | |||||
| Alternative sequence | 824 – 1055 | 232 | Missing in isoform 3. | VSP_009368 | |||||
| Alternative sequence | 1012 – 1055 | 44 | ATKPS…SSISF → V in isoform 2. | VSP_050630 | |||||
Experimental info | |||||||||
| Sequence conflict | 314 | 1 | Missing AA sequence Ref.6 | ||||||
| Sequence conflict | 481 | 1 | T → I in BAC86634. Ref.2 | ||||||
| Sequence conflict | 592 | 1 | L → I AA sequence Ref.6 | ||||||
| Sequence conflict | 705 | 1 | V → M AA sequence Ref.6 | ||||||
| Sequence conflict | 713 – 714 | 2 | LS → IN AA sequence Ref.6 | ||||||
| Sequence conflict | 843 | 1 | H → E AA sequence Ref.6 | ||||||
| Sequence conflict | 850 | 1 | R → K AA sequence Ref.6 | ||||||
| Sequence conflict | 867 | 1 | Y → R AA sequence Ref.6 | ||||||
| Sequence conflict | 958 | 1 | I → L AA sequence Ref.6 | ||||||
| Sequence conflict | 987 | 1 | Q → P AA sequence Ref.6 | ||||||
| Sequence conflict | 994 | 1 | S → G AA sequence Ref.6 | ||||||
| Isoform 4: | |||||||||
| Sequence conflict | 177 | 1 | L → P in BAD03968. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Homo sapiens cDNA, SNIP homolog." Sugiyama A., Inoue H., Oka M. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cerebellum. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Eye. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 294-1055 (ISOFORM 1). Tissue: Brain. |
| [6] | "p130Cas-associated protein (p140Cap) as a new tyrosine-phosphorylated protein involved in cell spreading." Di Stefano P., Cabodi S., Erba E.B., Margaria V., Bergatto E., Giuffrida M.G., Silengo L., Tarone G., Turco E., Defilippi P. Mol. Biol. Cell 15:787-800(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 306-325; 492-519; 583-593; 611-617; 700-719; 841-867; 884-895; 957-972; 983-1000 AND 1006-1017 (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH BCAR1, PHOSPHORYLATION. |
| [7] | "p140Cap protein suppresses tumour cell properties, regulating Csk and Src kinase activity." Di Stefano P., Damiano L., Cabodi S., Aramu S., Tordella L., Praduroux A., Piva R., Cavallo F., Forni G., Silengo L., Tarone G., Turco E., Defilippi P. EMBO J. 26:2843-2855(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CSK AND SRC. |
| [8] | "SNIP/p140Cap mRNA expression is an unfavourable prognostic factor in breast cancer and is not expressed in normal breast tissue." Kennedy S., Clynes M., Doolan P., Mehta J.P., Rani S., Crown J., O'Driscoll L. Br. J. Cancer 98:1641-1645(2008) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [9] | "Characterization of a multidomain adaptor protein, p140Cap, as part of a pre-synaptic complex." Ito H., Atsuzawa K., Sudo K., Di Stefano P., Iwamoto I., Morishita R., Takei S., Semba R., Defilippi P., Asano T., Usuda N., Nagata K. J. Neurochem. 107:61-72(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SORBS3 AND SYP. |
| [10] | "Dynamic microtubules regulate dendritic spine morphology and synaptic plasticity." Jaworski J., Kapitein L.C., Gouveia S.M., Dortland B.R., Wulf P.S., Grigoriev I., Camera P., Spangler S.A., Di Stefano P., Demmers J., Krugers H., Defilippi P., Akhmanova A., Hoogenraad C.C. Neuron 61:85-100(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CTTN AND MAPRE3, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB127405 mRNA. Translation: BAD03968.1. AK126665 mRNA. Translation: BAC86634.1. AC115090 Genomic DNA. No translation available. AC129916 Genomic DNA. No translation available. BC033233 mRNA. Translation: AAH33233.1. AB051471 mRNA. Translation: BAB21775.1. |
| IPI | IPI00384305. IPI00396130. IPI00479643. IPI00964306. |
| RefSeq | NP_079524.2. NM_025248.2. |
| UniGene | Hs.448872. |
3D structure databases | |
| ProteinModelPortal | Q9C0H9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9C0H9. 4 interactions. |
| MINT | MINT-4777404. |
| STRING | 9606.ENSP00000264659. |
PTM databases | |
| PhosphoSite | Q9C0H9. |
Polymorphism databases | |
| DMDM | 296452948. |
Proteomic databases | |
| PaxDb | Q9C0H9. |
| PRIDE | Q9C0H9. |
Protocols and materials databases | |
| DNASU | 80725. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264659; ENSP00000264659; ENSG00000017373. ENST00000570888; ENSP00000461232; ENSG00000262199. |
| GeneID | 80725. |
| KEGG | hsa:80725. |
| UCSC | uc002hqd.3. human. uc002hqf.1. human. uc002hqg.3. human. |
Organism-specific databases | |
| CTD | 80725. |
| GeneCards | GC17M036686. |
| H-InvDB | HIX0021064. |
| HGNC | HGNC:29506. SRCIN1. |
| HPA | HPA009701. |
| MIM | 610786. gene. |
| neXtProt | NX_Q9C0H9. |
| PharmGKB | PA165432823. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG69680. |
| HOGENOM | HOG000293351. |
| HOVERGEN | HBG019587. |
| InParanoid | Q9C0H9. |
| OMA | AELSMRV. |
| OrthoDB | EOG418BMM. |
Gene expression databases | |
| ArrayExpress | Q9C0H9. |
| Bgee | Q9C0H9. |
| Genevestigator | Q9C0H9. |
| GermOnline | ENSG00000017373. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR026727. Srcin1. [Graphical view] |
| PANTHER | PTHR22741:SF5. PTHR22741:SF5. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SRCIN1. human. |
| GenomeRNAi | 80725. |
| NextBio | 71035. |
| SOURCE | Search... |
Entry information
| Entry name | SRCN1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9C0H9 Secondary accession number(s): Q75T46, Q8N4W8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
