Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SRC kinase signaling inhibitor 1

Gene

SRCIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance.3 Publications

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

GO - Biological processi

  • exocytosis Source: UniProtKB-KW
  • negative regulation of protein secretion Source: Ensembl
  • negative regulation of protein tyrosine kinase activity Source: UniProtKB
  • positive regulation of protein tyrosine kinase activity Source: UniProtKB
  • regulation of cell migration Source: UniProtKB
  • regulation of dendritic spine morphogenesis Source: UniProtKB
  • substrate adhesion-dependent cell spreading Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Exocytosis

Enzyme and pathway databases

SIGNORiQ9C0H9.

Names & Taxonomyi

Protein namesi
Recommended name:
SRC kinase signaling inhibitor 1
Alternative name(s):
SNAP-25-interacting protein
Short name:
SNIP
p130Cas-associated protein
p140Cap
Gene namesi
Name:SRCIN1
Synonyms:KIAA1684, P140
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:29506. SRCIN1.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • axon Source: UniProtKB
  • cell junction Source: UniProtKB-KW
  • cytoplasm Source: UniProtKB
  • dendrite Source: UniProtKB
  • filopodium Source: Ensembl
  • lamellipodium Source: Ensembl
  • neuronal cell body Source: Ensembl
  • postsynaptic density Source: UniProtKB
  • postsynaptic membrane Source: UniProtKB-KW
  • synapse Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi80725.
OpenTargetsiENSG00000273608.
ENSG00000277363.
PharmGKBiPA165432823.

Chemistry databases

ChEMBLiCHEMBL2150836.

Polymorphism and mutation databases

BioMutaiSRCIN1.
DMDMi296452948.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000720111 – 1055SRC kinase signaling inhibitor 1Add BLAST1055

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei97PhosphoserineBy similarity1
Modified residuei113PhosphotyrosineBy similarity1
Modified residuei170PhosphoserineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei196PhosphoserineBy similarity1
Modified residuei201Omega-N-methylarginineBy similarity1
Modified residuei208Omega-N-methylarginineBy similarity1
Modified residuei215PhosphoserineBy similarity1
Modified residuei234PhosphoserineBy similarity1
Modified residuei236PhosphoserineCombined sources1
Modified residuei268PhosphotyrosineBy similarity1
Modified residuei365PhosphoserineBy similarity1
Modified residuei368PhosphoserineBy similarity1
Modified residuei372PhosphoserineBy similarity1
Modified residuei373Omega-N-methylarginineBy similarity1
Modified residuei375PhosphoserineBy similarity1
Modified residuei385PhosphoserineBy similarity1
Modified residuei387PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei394PhosphoserineBy similarity1
Modified residuei470PhosphoserineBy similarity1
Modified residuei493PhosphoserineBy similarity1
Modified residuei496PhosphothreonineBy similarity1
Modified residuei509PhosphothreonineBy similarity1
Modified residuei716PhosphoserineBy similarity1
Modified residuei729PhosphoserineCombined sources1
Modified residuei738PhosphoserineCombined sources1
Modified residuei756PhosphothreonineCombined sources1
Modified residuei859PhosphoserineBy similarity1
Modified residuei915PhosphoserineBy similarity1
Modified residuei932PhosphoserineBy similarity1
Isoform 4 (identifier: Q9C0H9-5)
Modified residuei45PhosphoserineCombined sourcesCurated1
Modified residuei52PhosphothreonineCombined sourcesCurated1
Modified residuei53PhosphoserineCombined sourcesCurated1
Modified residuei64PhosphoserineCombined sourcesCurated1

Post-translational modificationi

Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ9C0H9.
PaxDbiQ9C0H9.
PeptideAtlasiQ9C0H9.
PRIDEiQ9C0H9.

PTM databases

iPTMnetiQ9C0H9.
PhosphoSitePlusiQ9C0H9.

Expressioni

Tissue specificityi

Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue.1 Publication

Gene expression databases

BgeeiENSG00000017373.
ExpressionAtlasiQ9C0H9. baseline and differential.

Organism-specific databases

HPAiHPA009701.
HPA063795.

Interactioni

Subunit structurei

Interacts with the N-terminal coiled-coil region of SNAP25 (By similarity). Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BCAR1P569453EBI-1393949,EBI-702093
SRCP129313EBI-1393949,EBI-621482

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi123275. 10 interactors.
IntActiQ9C0H9. 4 interactors.
MINTiMINT-4777404.
STRINGi9606.ENSP00000264659.

Structurei

3D structure databases

ProteinModelPortaliQ9C0H9.
SMRiQ9C0H9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni519 – 569Interaction with SNAP25By similarityAdd BLAST51

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili433 – 460Sequence analysisAdd BLAST28
Coiled coili521 – 546Sequence analysisAdd BLAST26
Coiled coili588 – 650Sequence analysisAdd BLAST63

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi343 – 376Pro-richAdd BLAST34
Compositional biasi828 – 886Pro-richAdd BLAST59

Sequence similaritiesi

Belongs to the SRCIN1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IHFG. Eukaryota.
ENOG410XTBA. LUCA.
GeneTreeiENSGT00390000012399.
HOGENOMiHOG000293351.
HOVERGENiHBG019587.
InParanoidiQ9C0H9.
KOiK19930.
OMAiRESHHPP.
OrthoDBiEOG091G00Q1.
PhylomeDBiQ9C0H9.
TreeFamiTF332255.

Family and domain databases

InterProiIPR022782. AIP3_C.
IPR026727. Srcin1.
[Graphical view]
PANTHERiPTHR22741:SF5. PTHR22741:SF5. 1 hit.
PfamiPF03915. AIP3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1Curated (identifier: Q9C0H9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGAWVHLHS GAASSLRPCR CGAGAAPKSS PRSPGGRRGD GSSDSEGGVS
60 70 80 90 100
FAGVLFLQFG EETRRVHITH EVSSLDTLHA LIAHMFPQKL TMGMLKSPNT
110 120 130 140 150
AILIKDEARN VFYELEDVRD IQDRSIIKIY RKEPLYAAFP GSHLTNGDLR
160 170 180 190 200
REMVYASRES SPTRRLNNLS PAPHLASGSP PPGLPSGLPS GLQSGSPSRS
210 220 230 240 250
RLSYAGGRPP SYAGSPVHHA AERLGGAPAA QGVSPSPSAI LERRDVKPDE
260 270 280 290 300
DLASKAGGMV LVKGEGLYAD PYGLLHEGRL SLAAAAGDPF AYPGAGGLYK
310 320 330 340 350
RGSVRSLSTY SAAALQSDLE DSLYKAAGGG GPLYGDGYGF RLPPSSPQKL
360 370 380 390 400
ADVAAPPGGP PPPHSPYSGP PSRGSPVRQS FRKDSGSSSV FAESPGGKTR
410 420 430 440 450
SAGSASTAGA PPSELFPGPG ERSLVGFGPP VPAKDTETRE RMEAMEKQIA
460 470 480 490 500
SLTGLVQSAL LRGSEPETPS EKIEGSNGAA TPSAPCGSGG RSSGATPVSG
510 520 530 540 550
PPPPSASSTP AGQPTAVSRL QMQLHLRGLQ NSASDLRGQL QQLRKLQLQN
560 570 580 590 600
QESVRALLKR TEAELSMRVS EAARRQEDPL QRQRTLVEEE RLRYLNDEEL
610 620 630 640 650
ITQQLNDLEK SVEKIQRDVS HNHRLVPGPE LEEKALVLKQ LGETLTELKA
660 670 680 690 700
HFPGLQSKMR VVLRVEVEAV KFLKEEPQRL DGLLKRCRGV TDTLAQIRRQ
710 720 730 740 750
VDEGVWPPPN NLLSQSPKKV TAETDFNKSV DFEMPPPSPP LNLHELSGPA
760 770 780 790 800
EGASLTPKGG NPTKGLDTPG KRSVDKAVSV EAAERDWEEK RAALTQYSAK
810 820 830 840 850
DINRLLEETQ AELLKAIPDL DCASKAHPGP APTPDHKPPK APHGQKAAPR
860 870 880 890 900
TEPSGRRGSD ELTVPRYRTE KPSKSPPPPP PRRSFPSSHG LTTTRTGEVV
910 920 930 940 950
VTSKKDSAFI KKAESEELEV QKPQVKLRRA VSEVARPAST PPIMASAIKD
960 970 980 990 1000
EDDEDRIIAE LESGGGSVPP MKVVTPGASR LKAAQGQAGS PDKSKHGKQR
1010 1020 1030 1040 1050
AEYMRIQAQQ QATKPSKEMS GSNETSSPVS EKPSASRTSI PVLTSFGARN

SSISF
Length:1,055
Mass (Da):112,453
Last modified:May 18, 2010 - v3
Checksum:iCAB346DA20883EBD
GO
Isoform 2Curated (identifier: Q9C0H9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1012-1055: ATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSISF → V

Note: No experimental confirmation available.Curated
Show »
Length:1,012
Mass (Da):108,025
Checksum:i140EEB2BFB499E47
GO
Isoform 3 (identifier: Q9C0H9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-566: Missing.
     782-823: AAERDWEEKR...LKAIPDLDCA → VLGPGIVGGA...FFLGGGGPVP
     824-1055: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):28,590
Checksum:iFA12D8010D0C52D4
GO
Isoform 4 (identifier: Q9C0H9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MRGAWVHLHS...SDSEGGVSFA → MGNAPSQDPE...SASQTKLRSP

Show »
Length:1,183
Mass (Da):127,105
Checksum:i52BF566E715EF6FF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti314Missing AA sequence (PubMed:14657239).Curated1
Sequence conflicti481T → I in BAC86634 (PubMed:14702039).Curated1
Sequence conflicti592L → I AA sequence (PubMed:14657239).Curated1
Sequence conflicti705V → M AA sequence (PubMed:14657239).Curated1
Sequence conflicti713 – 714LS → IN AA sequence (PubMed:14657239).Curated2
Sequence conflicti843H → E AA sequence (PubMed:14657239).Curated1
Sequence conflicti850R → K AA sequence (PubMed:14657239).Curated1
Sequence conflicti867Y → R AA sequence (PubMed:14657239).Curated1
Sequence conflicti958I → L AA sequence (PubMed:14657239).Curated1
Sequence conflicti987Q → P AA sequence (PubMed:14657239).Curated1
Sequence conflicti994S → G AA sequence (PubMed:14657239).Curated1
Isoform 4 (identifier: Q9C0H9-5)
Sequence conflicti177L → P in BAD03968 (Ref. 1) Combined sourcesCurated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0093661 – 566Missing in isoform 3. 1 PublicationAdd BLAST566
Alternative sequenceiVSP_0392401 – 52MRGAW…GVSFA → MGNAPSQDPERSSPPMLSAD DAEYPREYRTLGGGGGGGSG GRRFSNVGLVHTSERRHTVI AAQSLEALSGLQKADADRKR DAFMDHLKSKYPQHALALRG QQDRMREQPNYWSFKTRSSR HTQGAQPGLADQAAKLSYAS AESLETMSEAELPLGFSRMN RFRQSLPLSRSASQTKLRSP in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_009367782 – 823AAERD…DLDCA → VLGPGIVGGAMSQVHTFLRP SFLEWGVPILWVFFLGGGGP VP in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_009368824 – 1055Missing in isoform 3. 1 PublicationAdd BLAST232
Alternative sequenceiVSP_0506301012 – 1055ATKPS…SSISF → V in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB127405 mRNA. Translation: BAD03968.1.
AK126665 mRNA. Translation: BAC86634.1.
AC115090 Genomic DNA. No translation available.
AC129916 Genomic DNA. No translation available.
BC033233 mRNA. Translation: AAH33233.1.
AB051471 mRNA. Translation: BAB21775.1.
CCDSiCCDS45660.1. [Q9C0H9-5]
RefSeqiNP_079524.2. NM_025248.2. [Q9C0H9-5]
UniGeneiHs.448872.

Genome annotation databases

EnsembliENST00000615049; ENSP00000480869; ENSG00000273608. [Q9C0H9-5]
ENST00000617146; ENSP00000484715; ENSG00000277363. [Q9C0H9-5]
GeneIDi80725.
KEGGihsa:80725.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB127405 mRNA. Translation: BAD03968.1.
AK126665 mRNA. Translation: BAC86634.1.
AC115090 Genomic DNA. No translation available.
AC129916 Genomic DNA. No translation available.
BC033233 mRNA. Translation: AAH33233.1.
AB051471 mRNA. Translation: BAB21775.1.
CCDSiCCDS45660.1. [Q9C0H9-5]
RefSeqiNP_079524.2. NM_025248.2. [Q9C0H9-5]
UniGeneiHs.448872.

3D structure databases

ProteinModelPortaliQ9C0H9.
SMRiQ9C0H9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123275. 10 interactors.
IntActiQ9C0H9. 4 interactors.
MINTiMINT-4777404.
STRINGi9606.ENSP00000264659.

Chemistry databases

ChEMBLiCHEMBL2150836.

PTM databases

iPTMnetiQ9C0H9.
PhosphoSitePlusiQ9C0H9.

Polymorphism and mutation databases

BioMutaiSRCIN1.
DMDMi296452948.

Proteomic databases

MaxQBiQ9C0H9.
PaxDbiQ9C0H9.
PeptideAtlasiQ9C0H9.
PRIDEiQ9C0H9.

Protocols and materials databases

DNASUi80725.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000615049; ENSP00000480869; ENSG00000273608. [Q9C0H9-5]
ENST00000617146; ENSP00000484715; ENSG00000277363. [Q9C0H9-5]
GeneIDi80725.
KEGGihsa:80725.

Organism-specific databases

CTDi80725.
DisGeNETi80725.
GeneCardsiSRCIN1.
H-InvDBHIX0021064.
HGNCiHGNC:29506. SRCIN1.
HPAiHPA009701.
HPA063795.
MIMi610786. gene.
neXtProtiNX_Q9C0H9.
OpenTargetsiENSG00000273608.
ENSG00000277363.
PharmGKBiPA165432823.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHFG. Eukaryota.
ENOG410XTBA. LUCA.
GeneTreeiENSGT00390000012399.
HOGENOMiHOG000293351.
HOVERGENiHBG019587.
InParanoidiQ9C0H9.
KOiK19930.
OMAiRESHHPP.
OrthoDBiEOG091G00Q1.
PhylomeDBiQ9C0H9.
TreeFamiTF332255.

Enzyme and pathway databases

SIGNORiQ9C0H9.

Miscellaneous databases

ChiTaRSiSRCIN1. human.
GenomeRNAii80725.
PROiQ9C0H9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000017373.
ExpressionAtlasiQ9C0H9. baseline and differential.

Family and domain databases

InterProiIPR022782. AIP3_C.
IPR026727. Srcin1.
[Graphical view]
PANTHERiPTHR22741:SF5. PTHR22741:SF5. 1 hit.
PfamiPF03915. AIP3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRCN1_HUMAN
AccessioniPrimary (citable) accession number: Q9C0H9
Secondary accession number(s): Q75T46, Q8N4W8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 131 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.