Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9C0H9

- SRCN1_HUMAN

UniProt

Q9C0H9 - SRCN1_HUMAN

Protein

SRC kinase signaling inhibitor 1

Gene

SRCIN1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance.3 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. protein kinase binding Source: UniProtKB

    GO - Biological processi

    1. exocytosis Source: UniProtKB-KW
    2. negative regulation of cell adhesion Source: Ensembl
    3. negative regulation of protein secretion Source: Ensembl
    4. negative regulation of protein tyrosine kinase activity Source: UniProtKB
    5. positive regulation of protein tyrosine kinase activity Source: UniProtKB
    6. regulation of cell migration Source: UniProtKB
    7. regulation of dendritic spine morphogenesis Source: UniProtKB
    8. substrate adhesion-dependent cell spreading Source: UniProtKB

    Keywords - Biological processi

    Exocytosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SRC kinase signaling inhibitor 1
    Alternative name(s):
    SNAP-25-interacting protein
    Short name:
    SNIP
    p130Cas-associated protein
    p140Cap
    Gene namesi
    Name:SRCIN1
    Synonyms:KIAA1684, P140
    OrganismiHomo sapiens (Human)Imported
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:29506. SRCIN1.

    Subcellular locationi

    Cytoplasm. Cytoplasmcytoskeleton. Cell projectionaxon By similarity. Cell projectiondendrite By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity
    Note: Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions.

    GO - Cellular componenti

    1. actin cytoskeleton Source: MGI
    2. axon Source: UniProtKB
    3. cell junction Source: UniProtKB-KW
    4. cytoplasm Source: UniProtKB
    5. dendrite Source: UniProtKB
    6. filopodium Source: Ensembl
    7. lamellipodium Source: Ensembl
    8. neuronal cell body Source: Ensembl
    9. postsynaptic density Source: UniProtKB
    10. postsynaptic membrane Source: UniProtKB-KW
    11. synapse Source: UniProtKB

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165432823.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10551055SRC kinase signaling inhibitor 1PRO_0000072011Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei113 – 1131PhosphotyrosineBy similarity
    Modified residuei215 – 2151PhosphoserineBy similarity
    Modified residuei268 – 2681PhosphotyrosineBy similarity
    Modified residuei394 – 3941PhosphoserineBy similarity
    Modified residuei779 – 7791PhosphoserineBy similarity
    Modified residuei859 – 8591PhosphoserineBy similarity
    Modified residuei915 – 9151PhosphoserineBy similarity

    Post-translational modificationi

    Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9C0H9.
    PaxDbiQ9C0H9.
    PRIDEiQ9C0H9.

    PTM databases

    PhosphoSiteiQ9C0H9.

    Expressioni

    Tissue specificityi

    Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue.1 Publication

    Gene expression databases

    ArrayExpressiQ9C0H9.
    BgeeiQ9C0H9.
    GenevestigatoriQ9C0H9.

    Organism-specific databases

    HPAiHPA009701.

    Interactioni

    Subunit structurei

    Interacts with the N-terminal coiled-coil region of SNAP25 By similarity. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3.By similarity4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BCAR1P569453EBI-1393949,EBI-702093
    SRCP129313EBI-1393949,EBI-621482

    Protein-protein interaction databases

    BioGridi123275. 7 interactions.
    IntActiQ9C0H9. 4 interactions.
    MINTiMINT-4777404.
    STRINGi9606.ENSP00000264659.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9C0H9.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni519 – 56951Interaction with SNAP25By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili433 – 46028Sequence AnalysisAdd
    BLAST
    Coiled coili521 – 54626Sequence AnalysisAdd
    BLAST
    Coiled coili588 – 65063Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi343 – 37634Pro-richAdd
    BLAST
    Compositional biasi828 – 88659Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SRCIN1 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG69680.
    HOGENOMiHOG000293351.
    HOVERGENiHBG019587.
    InParanoidiQ9C0H9.
    OMAiRESHHPP.
    PhylomeDBiQ9C0H9.
    TreeFamiTF332255.

    Family and domain databases

    InterProiIPR026727. Srcin1.
    [Graphical view]
    PANTHERiPTHR22741:SF5. PTHR22741:SF5. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1Curated (identifier: Q9C0H9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRGAWVHLHS GAASSLRPCR CGAGAAPKSS PRSPGGRRGD GSSDSEGGVS     50
    FAGVLFLQFG EETRRVHITH EVSSLDTLHA LIAHMFPQKL TMGMLKSPNT 100
    AILIKDEARN VFYELEDVRD IQDRSIIKIY RKEPLYAAFP GSHLTNGDLR 150
    REMVYASRES SPTRRLNNLS PAPHLASGSP PPGLPSGLPS GLQSGSPSRS 200
    RLSYAGGRPP SYAGSPVHHA AERLGGAPAA QGVSPSPSAI LERRDVKPDE 250
    DLASKAGGMV LVKGEGLYAD PYGLLHEGRL SLAAAAGDPF AYPGAGGLYK 300
    RGSVRSLSTY SAAALQSDLE DSLYKAAGGG GPLYGDGYGF RLPPSSPQKL 350
    ADVAAPPGGP PPPHSPYSGP PSRGSPVRQS FRKDSGSSSV FAESPGGKTR 400
    SAGSASTAGA PPSELFPGPG ERSLVGFGPP VPAKDTETRE RMEAMEKQIA 450
    SLTGLVQSAL LRGSEPETPS EKIEGSNGAA TPSAPCGSGG RSSGATPVSG 500
    PPPPSASSTP AGQPTAVSRL QMQLHLRGLQ NSASDLRGQL QQLRKLQLQN 550
    QESVRALLKR TEAELSMRVS EAARRQEDPL QRQRTLVEEE RLRYLNDEEL 600
    ITQQLNDLEK SVEKIQRDVS HNHRLVPGPE LEEKALVLKQ LGETLTELKA 650
    HFPGLQSKMR VVLRVEVEAV KFLKEEPQRL DGLLKRCRGV TDTLAQIRRQ 700
    VDEGVWPPPN NLLSQSPKKV TAETDFNKSV DFEMPPPSPP LNLHELSGPA 750
    EGASLTPKGG NPTKGLDTPG KRSVDKAVSV EAAERDWEEK RAALTQYSAK 800
    DINRLLEETQ AELLKAIPDL DCASKAHPGP APTPDHKPPK APHGQKAAPR 850
    TEPSGRRGSD ELTVPRYRTE KPSKSPPPPP PRRSFPSSHG LTTTRTGEVV 900
    VTSKKDSAFI KKAESEELEV QKPQVKLRRA VSEVARPAST PPIMASAIKD 950
    EDDEDRIIAE LESGGGSVPP MKVVTPGASR LKAAQGQAGS PDKSKHGKQR 1000
    AEYMRIQAQQ QATKPSKEMS GSNETSSPVS EKPSASRTSI PVLTSFGARN 1050
    SSISF 1055
    Length:1,055
    Mass (Da):112,453
    Last modified:May 18, 2010 - v3
    Checksum:iCAB346DA20883EBD
    GO
    Isoform 2Curated (identifier: Q9C0H9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1012-1055: ATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSISF → V

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,012
    Mass (Da):108,025
    Checksum:i140EEB2BFB499E47
    GO
    Isoform 3 (identifier: Q9C0H9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-566: Missing.
         782-823: AAERDWEEKR...LKAIPDLDCA → VLGPGIVGGA...FFLGGGGPVP
         824-1055: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:257
    Mass (Da):28,590
    Checksum:iFA12D8010D0C52D4
    GO
    Isoform 4 (identifier: Q9C0H9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: MRGAWVHLHS...SDSEGGVSFA → MGNAPSQDPE...SASQTKLRSP

    Show »
    Length:1,183
    Mass (Da):127,105
    Checksum:i52BF566E715EF6FF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti314 – 3141Missing AA sequence (PubMed:14657239)Curated
    Sequence conflicti481 – 4811T → I in BAC86634. (PubMed:14702039)Curated
    Sequence conflicti592 – 5921L → I AA sequence (PubMed:14657239)Curated
    Sequence conflicti705 – 7051V → M AA sequence (PubMed:14657239)Curated
    Sequence conflicti713 – 7142LS → IN AA sequence (PubMed:14657239)Curated
    Sequence conflicti843 – 8431H → E AA sequence (PubMed:14657239)Curated
    Sequence conflicti850 – 8501R → K AA sequence (PubMed:14657239)Curated
    Sequence conflicti867 – 8671Y → R AA sequence (PubMed:14657239)Curated
    Sequence conflicti958 – 9581I → L AA sequence (PubMed:14657239)Curated
    Sequence conflicti987 – 9871Q → P AA sequence (PubMed:14657239)Curated
    Sequence conflicti994 – 9941S → G AA sequence (PubMed:14657239)Curated
    Isoform 4 (identifier: Q9C0H9-5)
    Sequence conflicti177 – 1771L → P in BAD03968. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 566566Missing in isoform 3. 1 PublicationVSP_009366Add
    BLAST
    Alternative sequencei1 – 5252MRGAW…GVSFA → MGNAPSQDPERSSPPMLSAD DAEYPREYRTLGGGGGGGSG GRRFSNVGLVHTSERRHTVI AAQSLEALSGLQKADADRKR DAFMDHLKSKYPQHALALRG QQDRMREQPNYWSFKTRSSR HTQGAQPGLADQAAKLSYAS AESLETMSEAELPLGFSRMN RFRQSLPLSRSASQTKLRSP in isoform 4. 1 PublicationVSP_039240Add
    BLAST
    Alternative sequencei782 – 82342AAERD…DLDCA → VLGPGIVGGAMSQVHTFLRP SFLEWGVPILWVFFLGGGGP VP in isoform 3. 1 PublicationVSP_009367Add
    BLAST
    Alternative sequencei824 – 1055232Missing in isoform 3. 1 PublicationVSP_009368Add
    BLAST
    Alternative sequencei1012 – 105544ATKPS…SSISF → V in isoform 2. 1 PublicationVSP_050630Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB127405 mRNA. Translation: BAD03968.1.
    AK126665 mRNA. Translation: BAC86634.1.
    AC115090 Genomic DNA. No translation available.
    AC129916 Genomic DNA. No translation available.
    BC033233 mRNA. Translation: AAH33233.1.
    AB051471 mRNA. Translation: BAB21775.1.
    CCDSiCCDS45660.1. [Q9C0H9-5]
    RefSeqiNP_079524.2. NM_025248.2. [Q9C0H9-5]
    UniGeneiHs.448872.

    Genome annotation databases

    GeneIDi80725.
    KEGGihsa:80725.
    UCSCiuc002hqd.3. human. [Q9C0H9-5]
    uc002hqf.1. human. [Q9C0H9-2]
    uc002hqg.3. human. [Q9C0H9-4]

    Polymorphism databases

    DMDMi296452948.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB127405 mRNA. Translation: BAD03968.1 .
    AK126665 mRNA. Translation: BAC86634.1 .
    AC115090 Genomic DNA. No translation available.
    AC129916 Genomic DNA. No translation available.
    BC033233 mRNA. Translation: AAH33233.1 .
    AB051471 mRNA. Translation: BAB21775.1 .
    CCDSi CCDS45660.1. [Q9C0H9-5 ]
    RefSeqi NP_079524.2. NM_025248.2. [Q9C0H9-5 ]
    UniGenei Hs.448872.

    3D structure databases

    ProteinModelPortali Q9C0H9.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123275. 7 interactions.
    IntActi Q9C0H9. 4 interactions.
    MINTi MINT-4777404.
    STRINGi 9606.ENSP00000264659.

    Chemistry

    ChEMBLi CHEMBL2150836.

    PTM databases

    PhosphoSitei Q9C0H9.

    Polymorphism databases

    DMDMi 296452948.

    Proteomic databases

    MaxQBi Q9C0H9.
    PaxDbi Q9C0H9.
    PRIDEi Q9C0H9.

    Protocols and materials databases

    DNASUi 80725.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 80725.
    KEGGi hsa:80725.
    UCSCi uc002hqd.3. human. [Q9C0H9-5 ]
    uc002hqf.1. human. [Q9C0H9-2 ]
    uc002hqg.3. human. [Q9C0H9-4 ]

    Organism-specific databases

    CTDi 80725.
    GeneCardsi GC17M036686.
    H-InvDB HIX0021064.
    HGNCi HGNC:29506. SRCIN1.
    HPAi HPA009701.
    MIMi 610786. gene.
    neXtProti NX_Q9C0H9.
    PharmGKBi PA165432823.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG69680.
    HOGENOMi HOG000293351.
    HOVERGENi HBG019587.
    InParanoidi Q9C0H9.
    OMAi RESHHPP.
    PhylomeDBi Q9C0H9.
    TreeFami TF332255.

    Miscellaneous databases

    ChiTaRSi SRCIN1. human.
    GenomeRNAii 80725.
    NextBioi 71035.
    PROi Q9C0H9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9C0H9.
    Bgeei Q9C0H9.
    Genevestigatori Q9C0H9.

    Family and domain databases

    InterProi IPR026727. Srcin1.
    [Graphical view ]
    PANTHERi PTHR22741:SF5. PTHR22741:SF5. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Homo sapiens cDNA, SNIP homolog."
      Sugiyama A., Inoue H., Oka M.
      Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Cerebellum.
    3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Eye.
    5. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
      DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 294-1055 (ISOFORM 1).
      Tissue: Brain.
    6. "p130Cas-associated protein (p140Cap) as a new tyrosine-phosphorylated protein involved in cell spreading."
      Di Stefano P., Cabodi S., Erba E.B., Margaria V., Bergatto E., Giuffrida M.G., Silengo L., Tarone G., Turco E., Defilippi P.
      Mol. Biol. Cell 15:787-800(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 306-325; 492-519; 583-593; 611-617; 700-719; 841-867; 884-895; 957-972; 983-1000 AND 1006-1017 (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH BCAR1, PHOSPHORYLATION.
    7. "p140Cap protein suppresses tumour cell properties, regulating Csk and Src kinase activity."
      Di Stefano P., Damiano L., Cabodi S., Aramu S., Tordella L., Praduroux A., Piva R., Cavallo F., Forni G., Silengo L., Tarone G., Turco E., Defilippi P.
      EMBO J. 26:2843-2855(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CSK AND SRC.
    8. "SNIP/p140Cap mRNA expression is an unfavourable prognostic factor in breast cancer and is not expressed in normal breast tissue."
      Kennedy S., Clynes M., Doolan P., Mehta J.P., Rani S., Crown J., O'Driscoll L.
      Br. J. Cancer 98:1641-1645(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    9. "Characterization of a multidomain adaptor protein, p140Cap, as part of a pre-synaptic complex."
      Ito H., Atsuzawa K., Sudo K., Di Stefano P., Iwamoto I., Morishita R., Takei S., Semba R., Defilippi P., Asano T., Usuda N., Nagata K.
      J. Neurochem. 107:61-72(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SORBS3 AND SYP.
    10. Cited for: FUNCTION, INTERACTION WITH CTTN AND MAPRE3, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiSRCN1_HUMAN
    AccessioniPrimary (citable) accession number: Q9C0H9
    Secondary accession number(s): Q75T46, Q8N4W8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 16, 2004
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 114 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3