Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 39

Gene

ARHGAP39

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000147799-MONOMER.
ReactomeiR-HSA-194840. Rho GTPase cycle.
R-HSA-428543. Inactivation of Cdc42 and Rac.
SignaLinkiQ9C0H5.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 39
Gene namesi
Name:ARHGAP39
Synonyms:KIAA1688
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:29351. ARHGAP39.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000147799.
PharmGKBiPA165585391.

Polymorphism and mutation databases

BioMutaiARHGAP39.
DMDMi28380079.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000760922 – 1083Rho GTPase-activating protein 39Add BLAST1082

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei169PhosphoserineCombined sources1
Modified residuei286PhosphoserineCombined sources1
Modified residuei384PhosphoserineBy similarity1
Modified residuei388PhosphoserineCombined sources1
Modified residuei406PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei604PhosphoserineCombined sources1
Modified residuei690PhosphoserineCombined sources1
Modified residuei715PhosphoserineBy similarity1
Modified residuei726PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9C0H5.
PaxDbiQ9C0H5.
PeptideAtlasiQ9C0H5.
PRIDEiQ9C0H5.

PTM databases

iPTMnetiQ9C0H5.
PhosphoSitePlusiQ9C0H5.

Expressioni

Gene expression databases

BgeeiENSG00000147799.
GenevisibleiQ9C0H5. HS.

Organism-specific databases

HPAiHPA044491.

Interactioni

Protein-protein interaction databases

BioGridi123278. 14 interactors.
IntActiQ9C0H5. 13 interactors.
STRINGi9606.ENSP00000366522.

Structurei

3D structure databases

ProteinModelPortaliQ9C0H5.
SMRiQ9C0H5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 58WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini63 – 97WW 2PROSITE-ProRule annotationAdd BLAST35
Domaini722 – 879MyTH4PROSITE-ProRule annotationAdd BLAST158
Domaini890 – 1078Rho-GAPPROSITE-ProRule annotationAdd BLAST189

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi234 – 367Pro-richAdd BLAST134

Sequence similaritiesi

Contains 1 MyTH4 domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
Contains 2 WW domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IG4K. Eukaryota.
ENOG410XQ23. LUCA.
GeneTreeiENSGT00390000003161.
HOGENOMiHOG000290162.
HOVERGENiHBG104061.
InParanoidiQ9C0H5.
KOiK20649.
OMAiRTSSLRW.
OrthoDBiEOG091G0M6L.
PhylomeDBiQ9C0H5.
TreeFamiTF323577.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR000857. MyTH4_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00784. MyTH4. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00139. MyTH4. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00456. WW. 2 hits.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF51045. SSF51045. 1 hit.
PROSITEiPS51016. MYTH4. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50020. WW_DOMAIN_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0H5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQTQDYECR SHNVDLPESR IPGSNTRLEW VEIIEPRTRE RMYANLVTGE
60 70 80 90 100
CVWDPPAGVR IKRTSENQWW ELFDPNTSRF YYYNASTQRT VWHRPQGCDI
110 120 130 140 150
IPLAKLQTLK QNTESPRASA ESSPGRGSSV SREGSTSSSL EPEPDTEKAQ
160 170 180 190 200
ELPARAGRPA AFGTVKEDSG SSSPPGVFLE KDYEIYRDYS ADGQLLHYRT
210 220 230 240 250
SSLRWNSGAK ERMLIKVADR EPSFLAAQGN GYAPDGPPGV RSRRPSGSQH
260 270 280 290 300
SPSLQTFAPE ADGTIFFPER RPSPFLKRAE LPGSSSPLLA QPRKPSGDSQ
310 320 330 340 350
PSSPRYGYEP PLYEEPPVEY QAPIYDEPPM DVQFEAGGGY QAGSPQRSPG
360 370 380 390 400
RKPRPFLQPN KQGPPSPCQQ LVLTKQKCPE RFLSLEYSPA GKEYVRQLVY
410 420 430 440 450
VEQAGSSPKL RAGPRHKYAP NPGGGSYSLQ PSPCLLRDQR LGVKSGDYST
460 470 480 490 500
MEGPELRHSQ PPTPLPQAQE DAMSWSSQQD TLSSTGYSPG TRKRKSRKPS
510 520 530 540 550
LCQATSATPT EGPGDLLVEQ PLAEEQPPCG TSLAPVKRAE GEAEGARGAA
560 570 580 590 600
EPFLAQARLA WEAQQAHFHM KQRSSWDSQQ DGSGYESDGA LPLPMPGPVV
610 620 630 640 650
RAFSEDEALA QQENRHWRRG TFEKLGFPQI LLEKSVSVQT NLASPEPYLH
660 670 680 690 700
PSQSEDLAAC AQFESSRQSR SGVPSSSCVF PTFTLRKPSS ETDIENWASK
710 720 730 740 750
HFNKHTQGLF RRKVSIANML AWSSESIKKP MIVTSDRHVK KEACELFKLI
760 770 780 790 800
QMYMGDRRAK ADPLHVALEV ATKGWSVQGL RDELYIQLCR QTTENFRLES
810 820 830 840 850
LARGWELMAI CLAFFPPTPK FHSYLEGYIY RHMDPVNDTK GVAISTYAKY
860 870 880 890 900
CYHKLQKAAL TGAKKGLKKP NVEEIRHAKN AVFSPSMFGS ALQEVMGMQR
910 920 930 940 950
ERYPERQLPW VQTRLSEEVL ALNGDQTEGI FRVPGDIDEV NALKLQVDQW
960 970 980 990 1000
KVPTGLEDPH VPASLLKLWY RELEEPLIPH EFYEQCIAHY DSPEAAVAVV
1010 1020 1030 1040 1050
HALPRINRMV LCYLIRFLQV FVQPANVAVT KMDVSNLAMV MAPNCLRCQS
1060 1070 1080
DDPRVIFENT RKEMSFLRVL IQHLDTSFME GVL
Length:1,083
Mass (Da):121,286
Last modified:February 12, 2003 - v2
Checksum:i782B213B1DCB4072
GO
Isoform 2 (identifier: Q9C0H5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     840-840: K → KVTQHIKELLERNTKKKSKLRKKPKPYVEEPD

Show »
Length:1,114
Mass (Da):125,029
Checksum:iA232D306723FEAB6
GO

Sequence cautioni

The sequence BAB21779 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAG64793 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040749840K → KVTQHIKELLERNTKKKSKL RKKPKPYVEEPD in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051475 mRNA. Translation: BAB21779.1. Different initiation.
AC084125 Genomic DNA. No translation available.
AK303851 mRNA. Translation: BAG64793.1. Different initiation.
CCDSiCCDS34971.1. [Q9C0H5-2]
CCDS78374.1. [Q9C0H5-1]
PIRiC59434.
RefSeqiNP_001295136.1. NM_001308207.1. [Q9C0H5-1]
NP_001295137.1. NM_001308208.1. [Q9C0H5-1]
NP_079527.1. NM_025251.2. [Q9C0H5-2]
XP_011515610.1. XM_011517308.1. [Q9C0H5-2]
XP_011515611.1. XM_011517309.1. [Q9C0H5-2]
XP_016869359.1. XM_017013870.1. [Q9C0H5-2]
XP_016869360.1. XM_017013871.1. [Q9C0H5-2]
UniGeneiHs.148988.

Genome annotation databases

EnsembliENST00000276826; ENSP00000276826; ENSG00000147799. [Q9C0H5-1]
ENST00000377307; ENSP00000366522; ENSG00000147799. [Q9C0H5-2]
GeneIDi80728.
KEGGihsa:80728.
UCSCiuc064rpe.1. human. [Q9C0H5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051475 mRNA. Translation: BAB21779.1. Different initiation.
AC084125 Genomic DNA. No translation available.
AK303851 mRNA. Translation: BAG64793.1. Different initiation.
CCDSiCCDS34971.1. [Q9C0H5-2]
CCDS78374.1. [Q9C0H5-1]
PIRiC59434.
RefSeqiNP_001295136.1. NM_001308207.1. [Q9C0H5-1]
NP_001295137.1. NM_001308208.1. [Q9C0H5-1]
NP_079527.1. NM_025251.2. [Q9C0H5-2]
XP_011515610.1. XM_011517308.1. [Q9C0H5-2]
XP_011515611.1. XM_011517309.1. [Q9C0H5-2]
XP_016869359.1. XM_017013870.1. [Q9C0H5-2]
XP_016869360.1. XM_017013871.1. [Q9C0H5-2]
UniGeneiHs.148988.

3D structure databases

ProteinModelPortaliQ9C0H5.
SMRiQ9C0H5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123278. 14 interactors.
IntActiQ9C0H5. 13 interactors.
STRINGi9606.ENSP00000366522.

PTM databases

iPTMnetiQ9C0H5.
PhosphoSitePlusiQ9C0H5.

Polymorphism and mutation databases

BioMutaiARHGAP39.
DMDMi28380079.

Proteomic databases

MaxQBiQ9C0H5.
PaxDbiQ9C0H5.
PeptideAtlasiQ9C0H5.
PRIDEiQ9C0H5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000276826; ENSP00000276826; ENSG00000147799. [Q9C0H5-1]
ENST00000377307; ENSP00000366522; ENSG00000147799. [Q9C0H5-2]
GeneIDi80728.
KEGGihsa:80728.
UCSCiuc064rpe.1. human. [Q9C0H5-1]

Organism-specific databases

CTDi80728.
GeneCardsiARHGAP39.
H-InvDBHIX0007862.
HGNCiHGNC:29351. ARHGAP39.
HPAiHPA044491.
MIMi615880. gene.
neXtProtiNX_Q9C0H5.
OpenTargetsiENSG00000147799.
PharmGKBiPA165585391.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IG4K. Eukaryota.
ENOG410XQ23. LUCA.
GeneTreeiENSGT00390000003161.
HOGENOMiHOG000290162.
HOVERGENiHBG104061.
InParanoidiQ9C0H5.
KOiK20649.
OMAiRTSSLRW.
OrthoDBiEOG091G0M6L.
PhylomeDBiQ9C0H5.
TreeFamiTF323577.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000147799-MONOMER.
ReactomeiR-HSA-194840. Rho GTPase cycle.
R-HSA-428543. Inactivation of Cdc42 and Rac.
SignaLinkiQ9C0H5.

Miscellaneous databases

GenomeRNAii80728.
PROiQ9C0H5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000147799.
GenevisibleiQ9C0H5. HS.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR000857. MyTH4_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00784. MyTH4. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00397. WW. 1 hit.
[Graphical view]
SMARTiSM00139. MyTH4. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00456. WW. 2 hits.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF51045. SSF51045. 1 hit.
PROSITEiPS51016. MYTH4. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50020. WW_DOMAIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRHG39_HUMAN
AccessioniPrimary (citable) accession number: Q9C0H5
Secondary accession number(s): B4E1I1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 12, 2003
Last sequence update: February 12, 2003
Last modified: November 30, 2016
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.