Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dynein heavy chain 6, axonemal

Gene

DNAH6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi192 – 1998ATPSequence analysis
Nucleotide bindingi1472 – 14798ATPSequence analysis
Nucleotide bindingi1753 – 17608ATPSequence analysis
Nucleotide bindingi2096 – 21038ATPSequence analysis
Nucleotide bindingi2447 – 24548ATPSequence analysis

GO - Molecular functioni

  • ATPase activity Source: InterPro
  • ATP binding Source: UniProtKB-KW
  • microtubule motor activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dynein heavy chain 6, axonemal
Alternative name(s):
Axonemal beta dynein heavy chain 6
Ciliary dynein heavy chain 6
Gene namesi
Name:DNAH6
Synonyms:DNAHC6, DNHL1, HL2, KIAA1697
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:2951. DNAH6.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27404.

Polymorphism and mutation databases

BioMutaiDNAH6.
DMDMi166922150.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 41584158Dynein heavy chain 6, axonemalPRO_0000317665Add
BLAST

Proteomic databases

EPDiQ9C0G6.
PaxDbiQ9C0G6.
PeptideAtlasiQ9C0G6.
PRIDEiQ9C0G6.

PTM databases

iPTMnetiQ9C0G6.
PhosphoSiteiQ9C0G6.

Expressioni

Tissue specificityi

Detected in brain, testis and trachea.1 Publication

Gene expression databases

BgeeiENSG00000115423.
ExpressionAtlasiQ9C0G6. baseline and differential.
GenevisibleiQ9C0G6. HS.

Organism-specific databases

HPAiHPA036390.
HPA036391.

Interactioni

Subunit structurei

The dynein complex consists of at least two heavy chains and a number of intermediate and light chains.By similarity

Protein-protein interaction databases

BioGridi108107. 3 interactions.
STRINGi9606.ENSP00000237449.

Structurei

3D structure databases

ProteinModelPortaliQ9C0G6.
SMRiQ9C0G6. Positions 2706-2961, 3544-3772.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 14331433StemBy similarityAdd
BLAST
Regioni1434 – 1655222AAA 1By similarityAdd
BLAST
Regioni1715 – 1948234AAA 2By similarityAdd
BLAST
Regioni2058 – 2306249AAA 3By similarityAdd
BLAST
Regioni2408 – 2659252AAA 4By similarityAdd
BLAST
Regioni2676 – 2961286StalkBy similarityAdd
BLAST
Regioni3042 – 3272231AAA 5By similarityAdd
BLAST
Regioni3509 – 3730222AAA 6By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili805 – 85955Sequence analysisAdd
BLAST
Coiled coili2901 – 299696Sequence analysisAdd
BLAST

Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG3595. Eukaryota.
COG5245. LUCA.
GeneTreeiENSGT00760000118964.
InParanoidiQ9C0G6.
KOiK10408.
OMAiFDWQRQL.
OrthoDBiEOG091G00FO.
PhylomeDBiQ9C0G6.
TreeFamiTF352520.

Family and domain databases

Gene3Di3.40.50.300. 5 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011704. ATPase_dyneun-rel_AAA.
IPR026983. DHC_fam.
IPR026980. DNAH6.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 3 hits.
PTHR10676:SF136. PTHR10676:SF136. 3 hits.
PfamiPF07728. AAA_5. 1 hit.
PF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 4 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 5 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0G6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTFRATDSEF DLTNIEEYAE NSALSRLNNI KAKQRVSYVT STENESDTQI
60 70 80 90 100
LTFRHITKAQ EKTRKRQQPI KLEPLPVLKV YQDHKQPEYI HEQNRFQLMT
110 120 130 140 150
AGIIKRPVSI AKKSFATSST QFLEHQDAVK KMQIHRPYVE VFSPSPPKLP
160 170 180 190 200
HTGIGKRGLF GTRSSAYPKY TFHDREEVVK ANIRDPLQII KIIRENEHLG
210 220 230 240 250
FLYMIPAVPR SSIEYDTYNL KVVSYENINK NDYYTISQRA VTHIYNEDIE
260 270 280 290 300
FIEIDRWEQE YLYHRELTKI PIFSLFRKWK AFSVWRKNVR SKKITGCQKS
310 320 330 340 350
LQKNLFIVNP HLRPALLKIN ELCYHLSFMG LCYIEKCHTY TLQEFKAAQV
360 370 380 390 400
IRLAEVTERL GEFRNEAKYV VRRACRFALR AAGFVPDDCA FGPFEDYHKV
410 420 430 440 450
QSSGSFINTP HELPTYGDSE KMTYTEQASK RHYCMRLTCF IRLNDYLIEN
460 470 480 490 500
TMHILTVNAV NSLLNHLTDK LKRTPSADVI QKWITEEKPE VPDKKGTLMV
510 520 530 540 550
EKQEEDESLI PMFLTELMLT VQSLLFEPSL EDFLDGILGA VNHCQNTVLS
560 570 580 590 600
VPNLVPDSYF DAFTSPYINN KLEGKTCGTG PSLAAVFEDD KNFHTIISQI
610 620 630 640 650
KETIQAAFES ARIYAATFEK FQIFFKENES LDLQALKLQE PDINFFSEQL
660 670 680 690 700
EKYHKQHKDA VALRPTRNVG LLLIDTRLLR EKLIPSPLRC LEVLNFMLPR
710 720 730 740 750
QSKKKVDAII FEAQDAEYKL EFVPTTTTEY VHSLLFLDEI QERIESLEDE
760 770 780 790 800
GNIVTQMYKL MEQYQVPTPP EDFAVFATMK PSIVAVRNAI DKSVGDRESS
810 820 830 840 850
IKQFCVHLGS DLEELNNEVN EVKLQAQDPQ ILDISADQDK IRLILNNLQS
860 870 880 890 900
VLADLQKRAF QYKSYQKNFK VEVSKFEALE EVSAELKLKQ LLWDSFSEWD
910 920 930 940 950
KLQQEWLKSK FDCLDPEVLN GQVSKYAKFV TQLEKGLPPN SVVPQLKYKV
960 970 980 990 1000
EKMKEKLPVI IDLRNPTLKA RHWAAIEQTV DATLVDAEIP LTLERLSQLH
1010 1020 1030 1040 1050
VFDFGQEIQD ISGQASGEAA LEAILKKVED SWKTTEFVIL PHRDSKDVFI
1060 1070 1080 1090 1100
LGGTDDIQVL LDDSTINVAT LASSRYLGPL KTRVDEWQKQ LALFNQTLEE
1110 1120 1130 1140 1150
WLTCQRNWLY LESIFNAPDI QRQLPAEAKM FLQVDKSWKE IMRKVNRLPN
1160 1170 1180 1190 1200
ALRAATQPGL LETFQNNNAL LDQIQKCLEA YLESKRVIFP RFYFLSNDEL
1210 1220 1230 1240 1250
LEILAQTRNP QAVQPHLRKC FDSISKLEFA LMPPAEGKIP GIDGEPEKVY
1260 1270 1280 1290 1300
TNDILAMLSP EGERVSLGKG LKARGNVEEW LGKVEEAMFT SLRRLCKAAI
1310 1320 1330 1340 1350
ADYQGKLRTD WVVAGHPSQV ILTVSQIMWC RDLTECLETE HSNHIQALKN
1360 1370 1380 1390 1400
FEKVNFERLN ALAAIVQGSL PKLHRNILTA LITIDVHARD IVTELVQSKV
1410 1420 1430 1440 1450
ETVESFDWQR QLRYYWDIDL DNCVARMALS QYTYGYEYLG ACPRLVITPL
1460 1470 1480 1490 1500
TDRCYLCLMG ALQLDLGGAP AGPAGTGKTE TTKDLAKALA IQCVVFNCSD
1510 1520 1530 1540 1550
GLDYKMMGRF FSGLAQSGAW CCFDEFNRID IEVLSVIAQQ LITIRNAKAA
1560 1570 1580 1590 1600
KLSRFMFEGR EIKLVMTCAA FITMNPGYAG RTELPDNLKA LFRPFAMMVP
1610 1620 1630 1640 1650
NYALIAEVIL YSEGFESSKI LARKMTQMYK LCSEQLSQQD HYDFGMRAVK
1660 1670 1680 1690 1700
SVLVMAGSLK RENPDLNEDV VLIRALQDSN LPKFLTDDAL LFSGIISDLF
1710 1720 1730 1740 1750
PGVQIPEHDY GILQSTIVDV MNRQNLQPEM CMVRKVIQFY ETMLVRHGVM
1760 1770 1780 1790 1800
LVGPTGGGKT TVYRILAETL GNLQKLGIEN SFYQAVKTYV LNPKSITMGE
1810 1820 1830 1840 1850
LYGEVNNLTL EWKDGLMALS VRAAVNDTSE DHKWIISDGP VDALWIENMN
1860 1870 1880 1890 1900
TVLDDNKMLC LANSERIKLT PQIHMLFEVQ DLRVASPATV SRCGMVFVDP
1910 1920 1930 1940 1950
EELKWMPYVK TWMKGISKKL TEETQEYILN LFQRYVDEGL HFINKKCSQA
1960 1970 1980 1990 2000
IPQVDISKVT TLCCLLESLI LGKDGVNLAM EQTKLNTILC QTFVFCYLWS
2010 2020 2030 2040 2050
LGGNLTENYY DSFDTFIRTQ FDDNPDARLP NSGDLWSIHM DFDTKRLDPW
2060 2070 2080 2090 2100
ERIIPTFKYN RDVPFFEMLV PTTDTVRYGY LMEKLLAVKH SVLFTGITGV
2110 2120 2130 2140 2150
GKSVIAKGLL NKIQESAGYV PVYLNFSAQT SSARTQEIIE SKLERKRKNI
2160 2170 2180 2190 2200
LGAPGNKRIV IFVDDLNMPR LDRYGSQPPI ELLRQYQDFG GFYDRNKLFW
2210 2220 2230 2240 2250
KEIQDVTIIS ACAPPGGGRN PVTPRFIRHF SMLCLPMPSE HSLKQIFQAI
2260 2270 2280 2290 2300
LNGFLSDFPP AVKQTASSIV EASVEIYNKM SVDLLPTPAK SHYVFNLRDL
2310 2320 2330 2340 2350
SKCVQGILQC DPGTIREEIQ IFRLFCHECQ RVFHDRLINN EDKHYFHVIL
2360 2370 2380 2390 2400
TEMANKHFGI AIDLEYFLNK PIIFGDFIKF GADKADRIYD DMPDIEKTAN
2410 2420 2430 2440 2450
VLQDYLDDYN LTNPKEVKLV FFQDAIEHVS RIARMIRQER GNALLVGVGG
2460 2470 2480 2490 2500
TGKQSLTRLA AHICGYKCLQ IELSRGYNYD SFHEDLRKLY KMAGVEDKNM
2510 2520 2530 2540 2550
VFLFTDTQIV VEEFLEDINN ILNSGEVPNL FEKDELEQVL AATRPRAKEV
2560 2570 2580 2590 2600
GISEGNRDEV FQYFISKVRQ KLHIVLCMSP VGEAFRSRCR MFPSLVNCCT
2610 2620 2630 2640 2650
IDWFVQWPRE ALLSVSKTFF SQVDAGNEEL KEKLPLMCVN VHLSVSSMAE
2660 2670 2680 2690 2700
RYYNELRRRY YTTPTSYLEL INLYLSMLSE KRKQIISARD RVKNGLTKLL
2710 2720 2730 2740 2750
ETNILVDKMK LDLSALEPVL LAKSEDVEAL MEKLAVDQES ADQVRNTVQE
2760 2770 2780 2790 2800
DEATAKVKAE ETQAIADDAQ RDLDEALPAL DAANKALDSL DKADISEIRV
2810 2820 2830 2840 2850
FTKPPDLVMT VMEAISILLN AKPDWPSAKQ LLGDSNFLKR LLEYDKENIK
2860 2870 2880 2890 2900
PQILAKLQKY INNPDFVPEK VEKVSKACKS MCMWVRAMDL YSRVVKVVEP
2910 2920 2930 2940 2950
KRQKLRAAQA ELDITMATLR EKQALLRQVE DQIQALQDEY DKGVNEKESL
2960 2970 2980 2990 3000
AKTMALTKAR LVRAGKLTAA LEDEQVRWEE SIQKFEEEIS NITGNVFIAA
3010 3020 3030 3040 3050
ACVAYYGAFT AQYRQSLIEC WIQDCQSLEI PIDPSFSLIN ILGDPYEIRQ
3060 3070 3080 3090 3100
WNTDGLPRDL ISTENGILVT QGRRWPLMID PQDQANRWIR NKESKSGLKI
3110 3120 3130 3140 3150
IKLTDSNFLR ILENSIRLGL PVLLEELKET LDPALEPILL KQIFISGGRL
3160 3170 3180 3190 3200
LIRLGDSDID YDKNFRFYMT TKMPNPHYLP EVCIKVTIIN FTVTKSGLED
3210 3220 3230 3240 3250
QLLSDVVRLE KPRLEEQRIK LIVRINTDKN QLKTIEEKIL RMLFTSEGNI
3260 3270 3280 3290 3300
LDNEELIDTL QDSKITSGAI KTRLEEAEST EQMINVAREK YRPVATQGSV
3310 3320 3330 3340 3350
MYFVIASLSE IDPMYQYSLK YFKQLFNTTI ETSVKTENLQ QRLDVLLEQT
3360 3370 3380 3390 3400
LLTAYVNVSR GLFEQHKLIY SFMLCVEMMR QQGTLSDAEW NFFLRGSAGL
3410 3420 3430 3440 3450
EKERPPKPEA PWLPTATWFA CCDLEESFPV FHGLTQNILS HPISIRLGSF
3460 3470 3480 3490 3500
ETYINPQKWE GYSKMKHEDK HMRQEKEAAH QDPWSAGLSS FHKLILIKCC
3510 3520 3530 3540 3550
KEEKVVFALT DFVIENLGKQ FIETPPVDLP TLYQDMSCNT PLVFILSTGS
3560 3570 3580 3590 3600
DPMGAFQRFA RESGYSERVQ SISLGQGQGP IAEKMVKDAM KSGNWVFLQN
3610 3620 3630 3640 3650
CHLAVSWMLA MEELIKTFTD PDSAIKDTFR LFLSSMPSNT FPVTVLQNSV
3660 3670 3680 3690 3700
KVTNEPPKGL RANIRRAFTE MTPSFFEENI LGKKWRQIIF GICFFHAIIQ
3710 3720 3730 3740 3750
ERKKFGPLGW NICYEFNDSD RECALLNLKL YCKEGKIPWD ALIYITGEIT
3760 3770 3780 3790 3800
YGGRVTDSWD QRCLRTILKR FFSPETLEED YKYSESGIYF APMADSLQEF
3810 3820 3830 3840 3850
KDYIENLPLI DDPEIFGMHE NANLVFQYKE TSTLINTILE VQPRSSTGGE
3860 3870 3880 3890 3900
GKSNDEIVQE LVASVQTRVP EKLEMEGASE SLFVKDLQGR LNSLTTVLGQ
3910 3920 3930 3940 3950
EVDRFNNLLK LIHTSLETLN KAIAGFVVMS EEMEKVYNSF LNNQVPALWS
3960 3970 3980 3990 4000
NTAYPSLKPL GSWVKDLILR TSFVDLWLKR GQPKSYWISG FFFPQGFLTG
4010 4020 4030 4040 4050
TLQNHARKYN LPIDELSFKY SVIPTYRDQA AVIEAAKTVQ FGQELPMDME
4060 4070 4080 4090 4100
LPSPEDGVLV HGMFMDASRW DDKEMVIEDA LPGQMNPVLP VVHFEPQQNY
4110 4120 4130 4140 4150
KPSPTLYHCP LYKTGARAGT LSTTGHSTNF VVTVLLPSKR SKDYWIAKGS

ALLCQLSE
Length:4,158
Mass (Da):475,983
Last modified:February 5, 2008 - v3
Checksum:i8ADAA07BC375F683
GO
Isoform 2 (identifier: Q9C0G6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3241: Missing.
     3828-3833: YKETST → VCGLSS
     3834-4158: Missing.

Note: No experimental confirmation available.
Show »
Length:592
Mass (Da):67,987
Checksum:iA85D06CA292775D5
GO
Isoform 3 (identifier: Q9C0G6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-421: Missing.
     828-829: DP → VS
     830-4158: Missing.

Show »
Length:408
Mass (Da):46,770
Checksum:iFF235AE32DA3422E
GO
Isoform 4 (identifier: Q9C0G6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2306-2355: GILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMAN → D
     2561-2579: FQYFISKVRQKLHIVLCMS → GCARVVMWLYHKNVSSPFI
     2580-4158: Missing.

Note: No experimental confirmation available.
Show »
Length:2,530
Mass (Da):289,572
Checksum:i455378AD5AC8DD99
GO

Sequence cautioni

The sequence AAH15442 differs from that shown. Reason: Erroneous initiation. Curated
The sequence AAX93115 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence BAB15685 differs from that shown. Reason: Frameshift at position 3690. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1504 – 15041Y → C in CAA10559 (PubMed:11175280).Curated
Sequence conflicti1521 – 15211C → G in AAC50700 (PubMed:8812413).Curated
Sequence conflicti3716 – 37161F → S in BAB15685 (PubMed:14702039).Curated
Sequence conflicti3965 – 39651K → R in BAB15685 (PubMed:14702039).Curated
Sequence conflicti4151 – 41511A → V in BAB15685 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 32413241Missing in isoform 2. 1 PublicationVSP_031122Add
BLAST
Alternative sequencei1 – 421421Missing in isoform 3. 2 PublicationsVSP_031123Add
BLAST
Alternative sequencei828 – 8292DP → VS in isoform 3. 2 PublicationsVSP_031124
Alternative sequencei830 – 41583329Missing in isoform 3. 2 PublicationsVSP_031125Add
BLAST
Alternative sequencei2306 – 235550GILQC…TEMAN → D in isoform 4. 1 PublicationVSP_031126Add
BLAST
Alternative sequencei2561 – 257919FQYFI…VLCMS → GCARVVMWLYHKNVSSPFI in isoform 4. 1 PublicationVSP_031127Add
BLAST
Alternative sequencei2580 – 41581579Missing in isoform 4. 1 PublicationVSP_031128Add
BLAST
Alternative sequencei3828 – 38336YKETST → VCGLSS in isoform 2. 1 PublicationVSP_031129
Alternative sequencei3834 – 4158325Missing in isoform 2. 1 PublicationVSP_031130Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027182 mRNA. Translation: BAB15685.1. Frameshift.
AK094676 mRNA. Translation: BAC04400.1.
AL512706 mRNA. Translation: CAC21651.1.
AC010087 Genomic DNA. Translation: AAX93108.1.
AC096770 Genomic DNA. Translation: AAY24108.1.
AC098975 Genomic DNA. Translation: AAX93115.1. Sequence problems.
AC109827 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99557.1.
BC015442 mRNA. Translation: AAH15442.1. Different initiation.
BC104884 mRNA. Translation: AAI04885.1.
BC113424 mRNA. Translation: AAI13425.1.
BC117259 mRNA. Translation: AAI17260.1.
BC143666 mRNA. Translation: AAI43667.1.
U61736 mRNA. Translation: AAC50700.1.
AJ132086 mRNA. Translation: CAA10559.1.
AB051484 mRNA. Translation: BAB21788.2.
CCDSiCCDS46348.1. [Q9C0G6-1]
RefSeqiNP_001361.1. NM_001370.1. [Q9C0G6-1]
XP_006712019.1. XM_006711956.2. [Q9C0G6-1]
XP_011530951.1. XM_011532649.2. [Q9C0G6-1]
XP_011530952.1. XM_011532650.2. [Q9C0G6-1]
UniGeneiHs.249972.

Genome annotation databases

EnsembliENST00000237449; ENSP00000237449; ENSG00000115423. [Q9C0G6-1]
ENST00000389394; ENSP00000374045; ENSG00000115423. [Q9C0G6-1]
GeneIDi1768.
KEGGihsa:1768.
UCSCiuc002sor.4. human. [Q9C0G6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027182 mRNA. Translation: BAB15685.1. Frameshift.
AK094676 mRNA. Translation: BAC04400.1.
AL512706 mRNA. Translation: CAC21651.1.
AC010087 Genomic DNA. Translation: AAX93108.1.
AC096770 Genomic DNA. Translation: AAY24108.1.
AC098975 Genomic DNA. Translation: AAX93115.1. Sequence problems.
AC109827 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99557.1.
BC015442 mRNA. Translation: AAH15442.1. Different initiation.
BC104884 mRNA. Translation: AAI04885.1.
BC113424 mRNA. Translation: AAI13425.1.
BC117259 mRNA. Translation: AAI17260.1.
BC143666 mRNA. Translation: AAI43667.1.
U61736 mRNA. Translation: AAC50700.1.
AJ132086 mRNA. Translation: CAA10559.1.
AB051484 mRNA. Translation: BAB21788.2.
CCDSiCCDS46348.1. [Q9C0G6-1]
RefSeqiNP_001361.1. NM_001370.1. [Q9C0G6-1]
XP_006712019.1. XM_006711956.2. [Q9C0G6-1]
XP_011530951.1. XM_011532649.2. [Q9C0G6-1]
XP_011530952.1. XM_011532650.2. [Q9C0G6-1]
UniGeneiHs.249972.

3D structure databases

ProteinModelPortaliQ9C0G6.
SMRiQ9C0G6. Positions 2706-2961, 3544-3772.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108107. 3 interactions.
STRINGi9606.ENSP00000237449.

PTM databases

iPTMnetiQ9C0G6.
PhosphoSiteiQ9C0G6.

Polymorphism and mutation databases

BioMutaiDNAH6.
DMDMi166922150.

Proteomic databases

EPDiQ9C0G6.
PaxDbiQ9C0G6.
PeptideAtlasiQ9C0G6.
PRIDEiQ9C0G6.

Protocols and materials databases

DNASUi1768.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000237449; ENSP00000237449; ENSG00000115423. [Q9C0G6-1]
ENST00000389394; ENSP00000374045; ENSG00000115423. [Q9C0G6-1]
GeneIDi1768.
KEGGihsa:1768.
UCSCiuc002sor.4. human. [Q9C0G6-1]

Organism-specific databases

CTDi1768.
GeneCardsiDNAH6.
H-InvDBHIX0020124.
HGNCiHGNC:2951. DNAH6.
HPAiHPA036390.
HPA036391.
MIMi603336. gene.
neXtProtiNX_Q9C0G6.
PharmGKBiPA27404.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3595. Eukaryota.
COG5245. LUCA.
GeneTreeiENSGT00760000118964.
InParanoidiQ9C0G6.
KOiK10408.
OMAiFDWQRQL.
OrthoDBiEOG091G00FO.
PhylomeDBiQ9C0G6.
TreeFamiTF352520.

Miscellaneous databases

ChiTaRSiDNAH6. human.
GenomeRNAii1768.
PROiQ9C0G6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115423.
ExpressionAtlasiQ9C0G6. baseline and differential.
GenevisibleiQ9C0G6. HS.

Family and domain databases

Gene3Di3.40.50.300. 5 hits.
InterProiIPR003593. AAA+_ATPase.
IPR011704. ATPase_dyneun-rel_AAA.
IPR026983. DHC_fam.
IPR026980. DNAH6.
IPR024743. Dynein_HC_stalk.
IPR024317. Dynein_heavy_chain_D4_dom.
IPR004273. Dynein_heavy_dom.
IPR013602. Dynein_heavy_dom-2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR10676. PTHR10676. 3 hits.
PTHR10676:SF136. PTHR10676:SF136. 3 hits.
PfamiPF07728. AAA_5. 1 hit.
PF12780. AAA_8. 1 hit.
PF08393. DHC_N2. 1 hit.
PF03028. Dynein_heavy. 1 hit.
PF12777. MT. 1 hit.
[Graphical view]
SMARTiSM00382. AAA. 4 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 5 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiDYH6_HUMAN
AccessioniPrimary (citable) accession number: Q9C0G6
Secondary accession number(s): A0PJN9
, B5MEE0, B7ZL99, O95493, Q53QZ1, Q53TE5, Q8N1W6, Q92861, Q96BL6, Q9H030, Q9H5E1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: September 7, 2016
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.