SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9C0G0

- ZN407_HUMAN

UniProt

Q9C0G0 - ZN407_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc finger protein 407
Gene
ZNF407, KIAA1703
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri186 – 20823C2H2-type 1
Add
BLAST
Zinc fingeri215 – 23824C2H2-type 2
Add
BLAST
Zinc fingeri244 – 26825C2H2-type 3
Add
BLAST
Zinc fingeri528 – 55124C2H2-type 4
Add
BLAST
Zinc fingeri557 – 58125C2H2-type 5
Add
BLAST
Zinc fingeri615 – 63925C2H2-type 6
Add
BLAST
Zinc fingeri705 – 72824C2H2-type 7
Add
BLAST
Zinc fingeri850 – 87324C2H2-type 8
Add
BLAST
Zinc fingeri879 – 90325C2H2-type 9
Add
BLAST
Zinc fingeri1017 – 104024C2H2-type 10
Add
BLAST
Zinc fingeri1046 – 107025C2H2-type 11
Add
BLAST
Zinc fingeri1444 – 146825C2H2-type 12
Add
BLAST
Zinc fingeri1486 – 150924C2H2-type 13
Add
BLAST
Zinc fingeri1537 – 156125C2H2-type 14; degenerate
Add
BLAST
Zinc fingeri1567 – 158923C2H2-type 15
Add
BLAST
Zinc fingeri1595 – 161824C2H2-type 16
Add
BLAST
Zinc fingeri1628 – 165023C2H2-type 17
Add
BLAST
Zinc fingeri1656 – 168025C2H2-type 18
Add
BLAST
Zinc fingeri1686 – 170823C2H2-type 19
Add
BLAST
Zinc fingeri1714 – 173623C2H2-type 20
Add
BLAST
Zinc fingeri1742 – 176726C2H2-type 21
Add
BLAST
Zinc fingeri1773 – 179624C2H2-type 22
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 407
Gene namesi
Name:ZNF407
Synonyms:KIAA1703
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 18

Organism-specific databases

HGNCiHGNC:19904. ZNF407.

Subcellular locationi

Nucleus Reviewed prediction

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134942906.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 22482248Zinc finger protein 407
PRO_0000047568Add
BLAST

Proteomic databases

MaxQBiQ9C0G0.
PaxDbiQ9C0G0.
PRIDEiQ9C0G0.

PTM databases

PhosphoSiteiQ9C0G0.

Expressioni

Gene expression databases

BgeeiQ9C0G0.
CleanExiHS_ZNF407.
GenevestigatoriQ9C0G0.

Organism-specific databases

HPAiHPA028255.

Interactioni

Protein-protein interaction databases

BioGridi120767. 6 interactions.
IntActiQ9C0G0. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9C0G0.
SMRiQ9C0G0. Positions 203-250, 528-642, 702-754, 850-902, 1412-1796.

Family & Domainsi

Sequence similaritiesi

Contains 22 C2H2-type zinc fingers.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
HOGENOMiHOG000155792.
HOVERGENiHBG108768.
InParanoidiQ9C0G0.
OMAiNQHQQTA.
OrthoDBiEOG74R1PR.
PhylomeDBiQ9C0G0.
TreeFamiTF350895.

Family and domain databases

Gene3Di3.30.160.60. 7 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR003604. Znf_U1.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 25 hits.
SM00451. ZnF_U1. 7 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9C0G0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MMDSENKPEN DEDEKINKEA QDLTKLSSHN EDGGPVSDVI ASFPENSMGK     50
RGFSESSNSD SVVIGEDRNK HASKRRKLDE AEPLKSGKQG ICRLETSESS 100
VTEGGIALDE TGKETFLSDC TVGGTCLPNA LSPSCNFSTI DVVSLKTDTE 150
KTSAQEMVSL DLERESPFPP KEISVSCTIG NVDTVLKCSI CGHLFSSCSD 200
LEKHAESHMQ QPKEHTCCHC SHKAESSSAL HMHIKQAHGP QKVFSCDLCG 250
FQCSEENLLN AHYLGKTHLR RQNLAARGGF VQILTKQPFP KKSRTMATKN 300
VHSKPRTSKS IAKNSDSKGL RNVGSTFKDF RGSISKQSGS SSELLVEMMP 350
SRNTLSQEVE IVEEHVTSLG LAQNPENQSR KLDTLVTSEG LLEKLESTKN 400
TLQAAHGNSV TSRPRPERNI LVLGNSFRRR SSTFTLKGQA KKRFNLLGIK 450
RGTSETQRMY MKHLRTQMKT HDAESVLKHL EACSSVQRVC VTTSETQEAE 500
QGQGSARPPD SGLHSLTVKP ASGSQTLCAC TDCGQVATNR TDLEIHVKRC 550
HAREMKFYCR TCDFSSMSRR DLDEHLHSNQ HQQTASVLSC QCCSFISLDE 600
INLRDHMKEK HNMHFLCTPC NLFFLSEKDV EEHKATEKHI NSLVQPKTLQ 650
SSNSDLVLQT LPLSTLESEN AKESMDDSGK ASQEEPLKSR VSHGNEVRHS 700
SKPQFQCKKC FYKTRSSTVL TRHIKLRHGQ DYHFLCKACN LYSLSKEGME 750
KHIKRSKHLE NAKKNNIGLS FEECIERVCI GANDKKEEFD VSGNGRIEGH 800
IGVQLQEHSY LEKGMLASEE LSQSGGSTKD DELASTTTPK RGRPKGNISR 850
TCSHCGLLAS SITNLTVHIR RKHSHQYSYL CKVCKYYTVT KGDMERHCAT 900
KKHKGRVEIE ASGKHSSDII VGPEGGSLEA GKKNAGSAVT MSDEHANKPA 950
ESPTSVLEKP DRGNSIEAEV ENVFHSLDGE VNSHLLDKKE QISSEPEDFA 1000
QPGDVYSQRD VTGTGENKCL HCEFSAHSSA SLELHVKRKH TKEFEFYCMA 1050
CDYYAVTRRE MTRHAATEKH KMKRQSYLNS ANVEAGSADM SKNIIMPEEE 1100
HQQNSEEFQI ISGQPSDTLK SRNAADCSIL NENTNLDMSK VLCAADSVEV 1150
ETEEESNFNE DHSFCETFQQ APVKDKVRKP EEMMSLTMSS NYGSPSRFQN 1200
ENSGSSALNC ETAKKNHEIS NDAGELRVHC EGEGGNAGDG GGVVPHRHLC 1250
PVTLDGERSA ESPVLVVTRI TREQGNLESG GQNRVARGHG LEDLKGVQED 1300
PVLGNKEILM NSQHETEFIL EEDGPASDST VESSDVYETI ISIDDKGQAM 1350
YSFGRFDSSI IRIKNPEDGE LIDQSEEGLI ATGVRISELP LKDCAQGVKK 1400
KKSEGSSIGE STRIRCDDCG FLADGLSGLN VHIAMKHPTK EKHFHCLLCG 1450
KSFYTESNLH QHLASAGHMR NEQASVEELP EGGATFKCVK CTEPFDSEQN 1500
LFLHIKGQHE ELLREVNKYI VEDTEQINRE REENQGNVCK YCGKMCRSSN 1550
SMAFLAHIRT HTGSKPFKCK ICHFATAQLG DARNHVKRHL GMREYKCHVC 1600
GVAFVMKKHL NTHLLGKHGV GTPKERKFTC HLCDRSFTEK WALNNHMKLH 1650
TGEKPFKCTW PTCHYSFLTA SAMKDHYRTH TGEKSFLCDL CGFAGGTRHA 1700
LTKHRRQHTG EKPFKCDECN FASTTQSHLT RHKRVHTGEK PYRCPWCDYR 1750
SNCAENIRKH ILHTGKHEGV KMYNCPKCDY GTNVPVEFRN HLKEQHPDIE 1800
NPDLAYLHAG IVSKSYECRL KGQGATFVET DSPFTAAALA EEPLVKEKPL 1850
RSSRRPAPPP EQVQQVIIFQ GYDGEFALDP SVEETAAATL QTLAMAGQVA 1900
RVVHITEDGQ VIATSQSGAH VGSVVPGPIL PEQLADGATQ VVVVGGSMEG 1950
HGMDESLSPG GAVIQQVTKQ EILNLSEAGV APPEASSALD ALLCAVTELG 2000
EVEGRAGLEE QGRPGAKDVL IQLPGQEVSH VAADPEAPEI QMFPQAQESP 2050
AAVEVLTQVV HPSAAMASQE RAQVAFKKMV QGVLQFAVCD TAAAGQLVKD 2100
GVTQVVVSEE GAVHMVAGEG AQIIMQEAQG EHMDLVESDG EISQIIVTEE 2150
LVQAMVQESS GGFSEGTTHY ILTELPPGVQ DEPGLYSHTV LETADSQELL 2200
QAGATLGTEA GAPSRAEQLA SVVIYTQEGS SAAAAIQSQR ESSELQEA 2248
Length:2,248
Mass (Da):247,367
Last modified:October 23, 2007 - v2
Checksum:i1AE958917F5F7B91
GO
Isoform 2 (identifier: Q9C0G0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1811-1815: IVSKS → KGQKL
     1816-2248: Missing.

Note: No experimental confirmation available.

Show »
Length:1,815
Mass (Da):202,418
Checksum:i4C5D56BA3F87F5FD
GO
Isoform 3 (identifier: Q9C0G0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1625-1660: ERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTW → ERVKVAYRKIGTLPGIQNNRNASSASEAQSLCEHFS
     1661-2248: Missing.

Note: No experimental confirmation available.

Show »
Length:1,660
Mass (Da):184,081
Checksum:i8A585EBEA30D9E8D
GO

Sequence cautioni

The sequence BAA91077.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA91080.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691N → S.
Corresponds to variant rs3794942 [ dbSNP | Ensembl ].
VAR_052820
Natural varianti512 – 5121G → R.
Corresponds to variant rs7227263 [ dbSNP | Ensembl ].
VAR_052821
Natural varianti972 – 9721N → T.
Corresponds to variant rs948615 [ dbSNP | Ensembl ].
VAR_036694
Natural varianti1259 – 12591S → L.
Corresponds to variant rs34048449 [ dbSNP | Ensembl ].
VAR_061945
Natural varianti1913 – 19131A → T.
Corresponds to variant rs17056248 [ dbSNP | Ensembl ].
VAR_052822

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1625 – 166036ERKFT…FKCTW → ERVKVAYRKIGTLPGIQNNR NASSASEAQSLCEHFS in isoform 3.
VSP_028843Add
BLAST
Alternative sequencei1661 – 2248588Missing in isoform 3.
VSP_028844Add
BLAST
Alternative sequencei1811 – 18155IVSKS → KGQKL in isoform 2.
VSP_028845
Alternative sequencei1816 – 2248433Missing in isoform 2.
VSP_028846Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti988 – 9881K → E in BAA91077. 1 Publication
Sequence conflicti1297 – 12971V → D in BAA91077. 1 Publication
Sequence conflicti1353 – 13531F → S in BAA91077. 1 Publication
Sequence conflicti1415 – 14151R → C in BAA91077. 1 Publication
Sequence conflicti1520 – 15201I → V in BAA91077. 1 Publication
Sequence conflicti1584 – 15841N → D in BAA91080. 1 Publication
Sequence conflicti2181 – 21811D → G in AK023901. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC138660 Genomic DNA. No translation available.
AC091589 Genomic DNA. No translation available.
AC023380 Genomic DNA. No translation available.
AC100783 Genomic DNA. No translation available.
AC015819 Genomic DNA. No translation available.
AK000314 mRNA. Translation: BAA91077.1. Different initiation.
AK000317 mRNA. Translation: BAA91080.1. Different initiation.
AK023901 mRNA. No translation available.
AK056288 mRNA. Translation: BAB71139.1.
AB051490 mRNA. Translation: BAB21794.1.
CCDSiCCDS45885.1. [Q9C0G0-1]
CCDS54191.1. [Q9C0G0-3]
CCDS58634.1. [Q9C0G0-2]
RefSeqiNP_001139661.1. NM_001146189.1. [Q9C0G0-2]
NP_001139662.1. NM_001146190.1. [Q9C0G0-3]
NP_060227.2. NM_017757.2. [Q9C0G0-1]
XP_005266783.1. XM_005266726.2. [Q9C0G0-1]
UniGeneiHs.536490.

Genome annotation databases

EnsembliENST00000299687; ENSP00000299687; ENSG00000215421. [Q9C0G0-1]
ENST00000309902; ENSP00000310359; ENSG00000215421. [Q9C0G0-3]
ENST00000577538; ENSP00000463270; ENSG00000215421. [Q9C0G0-2]
ENST00000582337; ENSP00000462348; ENSG00000215421. [Q9C0G0-3]
GeneIDi55628.
KEGGihsa:55628.
UCSCiuc002llu.2. human. [Q9C0G0-1]
uc010dqu.2. human. [Q9C0G0-2]
uc010xfc.2. human. [Q9C0G0-3]

Polymorphism databases

DMDMi160358927.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC138660 Genomic DNA. No translation available.
AC091589 Genomic DNA. No translation available.
AC023380 Genomic DNA. No translation available.
AC100783 Genomic DNA. No translation available.
AC015819 Genomic DNA. No translation available.
AK000314 mRNA. Translation: BAA91077.1 . Different initiation.
AK000317 mRNA. Translation: BAA91080.1 . Different initiation.
AK023901 mRNA. No translation available.
AK056288 mRNA. Translation: BAB71139.1 .
AB051490 mRNA. Translation: BAB21794.1 .
CCDSi CCDS45885.1. [Q9C0G0-1 ]
CCDS54191.1. [Q9C0G0-3 ]
CCDS58634.1. [Q9C0G0-2 ]
RefSeqi NP_001139661.1. NM_001146189.1. [Q9C0G0-2 ]
NP_001139662.1. NM_001146190.1. [Q9C0G0-3 ]
NP_060227.2. NM_017757.2. [Q9C0G0-1 ]
XP_005266783.1. XM_005266726.2. [Q9C0G0-1 ]
UniGenei Hs.536490.

3D structure databases

ProteinModelPortali Q9C0G0.
SMRi Q9C0G0. Positions 203-250, 528-642, 702-754, 850-902, 1412-1796.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120767. 6 interactions.
IntActi Q9C0G0. 1 interaction.

PTM databases

PhosphoSitei Q9C0G0.

Polymorphism databases

DMDMi 160358927.

Proteomic databases

MaxQBi Q9C0G0.
PaxDbi Q9C0G0.
PRIDEi Q9C0G0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000299687 ; ENSP00000299687 ; ENSG00000215421 . [Q9C0G0-1 ]
ENST00000309902 ; ENSP00000310359 ; ENSG00000215421 . [Q9C0G0-3 ]
ENST00000577538 ; ENSP00000463270 ; ENSG00000215421 . [Q9C0G0-2 ]
ENST00000582337 ; ENSP00000462348 ; ENSG00000215421 . [Q9C0G0-3 ]
GeneIDi 55628.
KEGGi hsa:55628.
UCSCi uc002llu.2. human. [Q9C0G0-1 ]
uc010dqu.2. human. [Q9C0G0-2 ]
uc010xfc.2. human. [Q9C0G0-3 ]

Organism-specific databases

CTDi 55628.
GeneCardsi GC18P072345.
HGNCi HGNC:19904. ZNF407.
HPAi HPA028255.
neXtProti NX_Q9C0G0.
PharmGKBi PA134942906.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
HOGENOMi HOG000155792.
HOVERGENi HBG108768.
InParanoidi Q9C0G0.
OMAi NQHQQTA.
OrthoDBi EOG74R1PR.
PhylomeDBi Q9C0G0.
TreeFami TF350895.

Miscellaneous databases

ChiTaRSi ZNF407. human.
GenomeRNAii 55628.
NextBioi 60257.
PROi Q9C0G0.

Gene expression databases

Bgeei Q9C0G0.
CleanExi HS_ZNF407.
Genevestigatori Q9C0G0.

Family and domain databases

Gene3Di 3.30.160.60. 7 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR003604. Znf_U1.
[Graphical view ]
Pfami PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 25 hits.
SM00451. ZnF_U1. 7 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-784 AND 1998-2248 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 774-2248 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1124-2248 (ISOFORM 3).
    Tissue: Hepatoma, Teratocarcinoma and Thyroid.
  3. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1084-2248 (ISOFORM 1).
    Tissue: Brain.
  4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiZN407_HUMAN
AccessioniPrimary (citable) accession number: Q9C0G0
Secondary accession number(s): B5MD54
, Q96MY0, Q9H8A1, Q9NXD4, Q9NXD7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi