Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9C0G0

- ZN407_HUMAN

UniProt

Q9C0G0 - ZN407_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 407

Gene

ZNF407

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri186 – 20823C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri215 – 23824C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri244 – 26825C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri528 – 55124C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri557 – 58125C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri615 – 63925C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri705 – 72824C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri850 – 87324C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri879 – 90325C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1017 – 104024C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1046 – 107025C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1444 – 146825C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1486 – 150924C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1537 – 156125C2H2-type 14; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1567 – 158923C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1595 – 161824C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1628 – 165023C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1656 – 168025C2H2-type 18PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1686 – 170823C2H2-type 19PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1714 – 173623C2H2-type 20PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1742 – 176726C2H2-type 21PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1773 – 179624C2H2-type 22PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 407
Gene namesi
Name:ZNF407
Synonyms:KIAA1703
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 18

Organism-specific databases

HGNCiHGNC:19904. ZNF407.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134942906.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 22482248Zinc finger protein 407PRO_0000047568Add
BLAST

Proteomic databases

MaxQBiQ9C0G0.
PaxDbiQ9C0G0.
PRIDEiQ9C0G0.

PTM databases

PhosphoSiteiQ9C0G0.

Expressioni

Gene expression databases

BgeeiQ9C0G0.
CleanExiHS_ZNF407.
GenevestigatoriQ9C0G0.

Organism-specific databases

HPAiHPA028255.

Interactioni

Protein-protein interaction databases

BioGridi120767. 6 interactions.
IntActiQ9C0G0. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ9C0G0.
SMRiQ9C0G0. Positions 176-250, 1009-1052, 1442-1796.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 22 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri186 – 20823C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri215 – 23824C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri244 – 26825C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri528 – 55124C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri557 – 58125C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri615 – 63925C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri705 – 72824C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri850 – 87324C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri879 – 90325C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1017 – 104024C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1046 – 107025C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1444 – 146825C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1486 – 150924C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1537 – 156125C2H2-type 14; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1567 – 158923C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1595 – 161824C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1628 – 165023C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1656 – 168025C2H2-type 18PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1686 – 170823C2H2-type 19PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1714 – 173623C2H2-type 20PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1742 – 176726C2H2-type 21PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1773 – 179624C2H2-type 22PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00530000063458.
HOGENOMiHOG000155792.
HOVERGENiHBG108768.
InParanoidiQ9C0G0.
OMAiNQHQQTA.
OrthoDBiEOG74R1PR.
PhylomeDBiQ9C0G0.
TreeFamiTF350895.

Family and domain databases

Gene3Di3.30.160.60. 7 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR003604. Znf_U1.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 25 hits.
SM00451. ZnF_U1. 7 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9C0G0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMDSENKPEN DEDEKINKEA QDLTKLSSHN EDGGPVSDVI ASFPENSMGK
60 70 80 90 100
RGFSESSNSD SVVIGEDRNK HASKRRKLDE AEPLKSGKQG ICRLETSESS
110 120 130 140 150
VTEGGIALDE TGKETFLSDC TVGGTCLPNA LSPSCNFSTI DVVSLKTDTE
160 170 180 190 200
KTSAQEMVSL DLERESPFPP KEISVSCTIG NVDTVLKCSI CGHLFSSCSD
210 220 230 240 250
LEKHAESHMQ QPKEHTCCHC SHKAESSSAL HMHIKQAHGP QKVFSCDLCG
260 270 280 290 300
FQCSEENLLN AHYLGKTHLR RQNLAARGGF VQILTKQPFP KKSRTMATKN
310 320 330 340 350
VHSKPRTSKS IAKNSDSKGL RNVGSTFKDF RGSISKQSGS SSELLVEMMP
360 370 380 390 400
SRNTLSQEVE IVEEHVTSLG LAQNPENQSR KLDTLVTSEG LLEKLESTKN
410 420 430 440 450
TLQAAHGNSV TSRPRPERNI LVLGNSFRRR SSTFTLKGQA KKRFNLLGIK
460 470 480 490 500
RGTSETQRMY MKHLRTQMKT HDAESVLKHL EACSSVQRVC VTTSETQEAE
510 520 530 540 550
QGQGSARPPD SGLHSLTVKP ASGSQTLCAC TDCGQVATNR TDLEIHVKRC
560 570 580 590 600
HAREMKFYCR TCDFSSMSRR DLDEHLHSNQ HQQTASVLSC QCCSFISLDE
610 620 630 640 650
INLRDHMKEK HNMHFLCTPC NLFFLSEKDV EEHKATEKHI NSLVQPKTLQ
660 670 680 690 700
SSNSDLVLQT LPLSTLESEN AKESMDDSGK ASQEEPLKSR VSHGNEVRHS
710 720 730 740 750
SKPQFQCKKC FYKTRSSTVL TRHIKLRHGQ DYHFLCKACN LYSLSKEGME
760 770 780 790 800
KHIKRSKHLE NAKKNNIGLS FEECIERVCI GANDKKEEFD VSGNGRIEGH
810 820 830 840 850
IGVQLQEHSY LEKGMLASEE LSQSGGSTKD DELASTTTPK RGRPKGNISR
860 870 880 890 900
TCSHCGLLAS SITNLTVHIR RKHSHQYSYL CKVCKYYTVT KGDMERHCAT
910 920 930 940 950
KKHKGRVEIE ASGKHSSDII VGPEGGSLEA GKKNAGSAVT MSDEHANKPA
960 970 980 990 1000
ESPTSVLEKP DRGNSIEAEV ENVFHSLDGE VNSHLLDKKE QISSEPEDFA
1010 1020 1030 1040 1050
QPGDVYSQRD VTGTGENKCL HCEFSAHSSA SLELHVKRKH TKEFEFYCMA
1060 1070 1080 1090 1100
CDYYAVTRRE MTRHAATEKH KMKRQSYLNS ANVEAGSADM SKNIIMPEEE
1110 1120 1130 1140 1150
HQQNSEEFQI ISGQPSDTLK SRNAADCSIL NENTNLDMSK VLCAADSVEV
1160 1170 1180 1190 1200
ETEEESNFNE DHSFCETFQQ APVKDKVRKP EEMMSLTMSS NYGSPSRFQN
1210 1220 1230 1240 1250
ENSGSSALNC ETAKKNHEIS NDAGELRVHC EGEGGNAGDG GGVVPHRHLC
1260 1270 1280 1290 1300
PVTLDGERSA ESPVLVVTRI TREQGNLESG GQNRVARGHG LEDLKGVQED
1310 1320 1330 1340 1350
PVLGNKEILM NSQHETEFIL EEDGPASDST VESSDVYETI ISIDDKGQAM
1360 1370 1380 1390 1400
YSFGRFDSSI IRIKNPEDGE LIDQSEEGLI ATGVRISELP LKDCAQGVKK
1410 1420 1430 1440 1450
KKSEGSSIGE STRIRCDDCG FLADGLSGLN VHIAMKHPTK EKHFHCLLCG
1460 1470 1480 1490 1500
KSFYTESNLH QHLASAGHMR NEQASVEELP EGGATFKCVK CTEPFDSEQN
1510 1520 1530 1540 1550
LFLHIKGQHE ELLREVNKYI VEDTEQINRE REENQGNVCK YCGKMCRSSN
1560 1570 1580 1590 1600
SMAFLAHIRT HTGSKPFKCK ICHFATAQLG DARNHVKRHL GMREYKCHVC
1610 1620 1630 1640 1650
GVAFVMKKHL NTHLLGKHGV GTPKERKFTC HLCDRSFTEK WALNNHMKLH
1660 1670 1680 1690 1700
TGEKPFKCTW PTCHYSFLTA SAMKDHYRTH TGEKSFLCDL CGFAGGTRHA
1710 1720 1730 1740 1750
LTKHRRQHTG EKPFKCDECN FASTTQSHLT RHKRVHTGEK PYRCPWCDYR
1760 1770 1780 1790 1800
SNCAENIRKH ILHTGKHEGV KMYNCPKCDY GTNVPVEFRN HLKEQHPDIE
1810 1820 1830 1840 1850
NPDLAYLHAG IVSKSYECRL KGQGATFVET DSPFTAAALA EEPLVKEKPL
1860 1870 1880 1890 1900
RSSRRPAPPP EQVQQVIIFQ GYDGEFALDP SVEETAAATL QTLAMAGQVA
1910 1920 1930 1940 1950
RVVHITEDGQ VIATSQSGAH VGSVVPGPIL PEQLADGATQ VVVVGGSMEG
1960 1970 1980 1990 2000
HGMDESLSPG GAVIQQVTKQ EILNLSEAGV APPEASSALD ALLCAVTELG
2010 2020 2030 2040 2050
EVEGRAGLEE QGRPGAKDVL IQLPGQEVSH VAADPEAPEI QMFPQAQESP
2060 2070 2080 2090 2100
AAVEVLTQVV HPSAAMASQE RAQVAFKKMV QGVLQFAVCD TAAAGQLVKD
2110 2120 2130 2140 2150
GVTQVVVSEE GAVHMVAGEG AQIIMQEAQG EHMDLVESDG EISQIIVTEE
2160 2170 2180 2190 2200
LVQAMVQESS GGFSEGTTHY ILTELPPGVQ DEPGLYSHTV LETADSQELL
2210 2220 2230 2240
QAGATLGTEA GAPSRAEQLA SVVIYTQEGS SAAAAIQSQR ESSELQEA
Length:2,248
Mass (Da):247,367
Last modified:October 23, 2007 - v2
Checksum:i1AE958917F5F7B91
GO
Isoform 2 (identifier: Q9C0G0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1811-1815: IVSKS → KGQKL
     1816-2248: Missing.

Note: No experimental confirmation available.

Show »
Length:1,815
Mass (Da):202,418
Checksum:i4C5D56BA3F87F5FD
GO
Isoform 3 (identifier: Q9C0G0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1625-1660: ERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTW → ERVKVAYRKIGTLPGIQNNRNASSASEAQSLCEHFS
     1661-2248: Missing.

Note: No experimental confirmation available.

Show »
Length:1,660
Mass (Da):184,081
Checksum:i8A585EBEA30D9E8D
GO

Sequence cautioni

The sequence BAA91077.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA91080.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti988 – 9881K → E in BAA91077. (PubMed:14702039)Curated
Sequence conflicti1297 – 12971V → D in BAA91077. (PubMed:14702039)Curated
Sequence conflicti1353 – 13531F → S in BAA91077. (PubMed:14702039)Curated
Sequence conflicti1415 – 14151R → C in BAA91077. (PubMed:14702039)Curated
Sequence conflicti1520 – 15201I → V in BAA91077. (PubMed:14702039)Curated
Sequence conflicti1584 – 15841N → D in BAA91080. (PubMed:14702039)Curated
Sequence conflicti2181 – 21811D → G in AK023901. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691N → S.
Corresponds to variant rs3794942 [ dbSNP | Ensembl ].
VAR_052820
Natural varianti512 – 5121G → R.
Corresponds to variant rs7227263 [ dbSNP | Ensembl ].
VAR_052821
Natural varianti972 – 9721N → T.
Corresponds to variant rs948615 [ dbSNP | Ensembl ].
VAR_036694
Natural varianti1259 – 12591S → L.
Corresponds to variant rs34048449 [ dbSNP | Ensembl ].
VAR_061945
Natural varianti1913 – 19131A → T.
Corresponds to variant rs17056248 [ dbSNP | Ensembl ].
VAR_052822

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1625 – 166036ERKFT…FKCTW → ERVKVAYRKIGTLPGIQNNR NASSASEAQSLCEHFS in isoform 3. 1 PublicationVSP_028843Add
BLAST
Alternative sequencei1661 – 2248588Missing in isoform 3. 1 PublicationVSP_028844Add
BLAST
Alternative sequencei1811 – 18155IVSKS → KGQKL in isoform 2. 1 PublicationVSP_028845
Alternative sequencei1816 – 2248433Missing in isoform 2. 1 PublicationVSP_028846Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC138660 Genomic DNA. No translation available.
AC091589 Genomic DNA. No translation available.
AC023380 Genomic DNA. No translation available.
AC100783 Genomic DNA. No translation available.
AC015819 Genomic DNA. No translation available.
AK000314 mRNA. Translation: BAA91077.1. Different initiation.
AK000317 mRNA. Translation: BAA91080.1. Different initiation.
AK023901 mRNA. No translation available.
AK056288 mRNA. Translation: BAB71139.1.
AB051490 mRNA. Translation: BAB21794.1.
CCDSiCCDS45885.1. [Q9C0G0-1]
CCDS54191.1. [Q9C0G0-3]
CCDS58634.1. [Q9C0G0-2]
RefSeqiNP_001139661.1. NM_001146189.1. [Q9C0G0-2]
NP_001139662.1. NM_001146190.1. [Q9C0G0-3]
NP_060227.2. NM_017757.2. [Q9C0G0-1]
XP_005266783.1. XM_005266726.2. [Q9C0G0-1]
UniGeneiHs.536490.

Genome annotation databases

EnsembliENST00000299687; ENSP00000299687; ENSG00000215421. [Q9C0G0-1]
ENST00000309902; ENSP00000310359; ENSG00000215421. [Q9C0G0-3]
ENST00000577538; ENSP00000463270; ENSG00000215421. [Q9C0G0-2]
ENST00000582337; ENSP00000462348; ENSG00000215421. [Q9C0G0-3]
GeneIDi55628.
KEGGihsa:55628.
UCSCiuc002llu.2. human. [Q9C0G0-1]
uc010dqu.2. human. [Q9C0G0-2]
uc010xfc.2. human. [Q9C0G0-3]

Polymorphism databases

DMDMi160358927.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC138660 Genomic DNA. No translation available.
AC091589 Genomic DNA. No translation available.
AC023380 Genomic DNA. No translation available.
AC100783 Genomic DNA. No translation available.
AC015819 Genomic DNA. No translation available.
AK000314 mRNA. Translation: BAA91077.1 . Different initiation.
AK000317 mRNA. Translation: BAA91080.1 . Different initiation.
AK023901 mRNA. No translation available.
AK056288 mRNA. Translation: BAB71139.1 .
AB051490 mRNA. Translation: BAB21794.1 .
CCDSi CCDS45885.1. [Q9C0G0-1 ]
CCDS54191.1. [Q9C0G0-3 ]
CCDS58634.1. [Q9C0G0-2 ]
RefSeqi NP_001139661.1. NM_001146189.1. [Q9C0G0-2 ]
NP_001139662.1. NM_001146190.1. [Q9C0G0-3 ]
NP_060227.2. NM_017757.2. [Q9C0G0-1 ]
XP_005266783.1. XM_005266726.2. [Q9C0G0-1 ]
UniGenei Hs.536490.

3D structure databases

ProteinModelPortali Q9C0G0.
SMRi Q9C0G0. Positions 176-250, 1009-1052, 1442-1796.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120767. 6 interactions.
IntActi Q9C0G0. 1 interaction.

PTM databases

PhosphoSitei Q9C0G0.

Polymorphism databases

DMDMi 160358927.

Proteomic databases

MaxQBi Q9C0G0.
PaxDbi Q9C0G0.
PRIDEi Q9C0G0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000299687 ; ENSP00000299687 ; ENSG00000215421 . [Q9C0G0-1 ]
ENST00000309902 ; ENSP00000310359 ; ENSG00000215421 . [Q9C0G0-3 ]
ENST00000577538 ; ENSP00000463270 ; ENSG00000215421 . [Q9C0G0-2 ]
ENST00000582337 ; ENSP00000462348 ; ENSG00000215421 . [Q9C0G0-3 ]
GeneIDi 55628.
KEGGi hsa:55628.
UCSCi uc002llu.2. human. [Q9C0G0-1 ]
uc010dqu.2. human. [Q9C0G0-2 ]
uc010xfc.2. human. [Q9C0G0-3 ]

Organism-specific databases

CTDi 55628.
GeneCardsi GC18P072345.
HGNCi HGNC:19904. ZNF407.
HPAi HPA028255.
neXtProti NX_Q9C0G0.
PharmGKBi PA134942906.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00530000063458.
HOGENOMi HOG000155792.
HOVERGENi HBG108768.
InParanoidi Q9C0G0.
OMAi NQHQQTA.
OrthoDBi EOG74R1PR.
PhylomeDBi Q9C0G0.
TreeFami TF350895.

Miscellaneous databases

ChiTaRSi ZNF407. human.
GenomeRNAii 55628.
NextBioi 60257.
PROi Q9C0G0.

Gene expression databases

Bgeei Q9C0G0.
CleanExi HS_ZNF407.
Genevestigatori Q9C0G0.

Family and domain databases

Gene3Di 3.30.160.60. 7 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR003604. Znf_U1.
[Graphical view ]
Pfami PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 25 hits.
SM00451. ZnF_U1. 7 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-784 AND 1998-2248 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 774-2248 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1124-2248 (ISOFORM 3).
    Tissue: Hepatoma, Teratocarcinoma and Thyroid.
  3. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1084-2248 (ISOFORM 1).
    Tissue: Brain.
  4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiZN407_HUMAN
AccessioniPrimary (citable) accession number: Q9C0G0
Secondary accession number(s): B5MD54
, Q96MY0, Q9H8A1, Q9NXD4, Q9NXD7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: October 23, 2007
Last modified: October 29, 2014
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3