Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9C0G0 (ZN407_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 407
Gene names
Name:ZNF407
Synonyms:KIAA1703
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2248 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subcellular location

Nucleus Potential.

Sequence similarities

Contains 22 C2H2-type zinc fingers.

Sequence caution

The sequence BAA91077.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAA91080.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9C0G0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9C0G0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1811-1815: IVSKS → KGQKL
     1816-2248: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9C0G0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1625-1660: ERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTW → ERVKVAYRKIGTLPGIQNNRNASSASEAQSLCEHFS
     1661-2248: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 22482248Zinc finger protein 407
PRO_0000047568

Regions

Zinc finger186 – 20823C2H2-type 1
Zinc finger215 – 23824C2H2-type 2
Zinc finger244 – 26825C2H2-type 3
Zinc finger528 – 55124C2H2-type 4
Zinc finger557 – 58125C2H2-type 5
Zinc finger615 – 63925C2H2-type 6
Zinc finger705 – 72824C2H2-type 7
Zinc finger850 – 87324C2H2-type 8
Zinc finger879 – 90325C2H2-type 9
Zinc finger1017 – 104024C2H2-type 10
Zinc finger1046 – 107025C2H2-type 11
Zinc finger1444 – 146825C2H2-type 12
Zinc finger1486 – 150924C2H2-type 13
Zinc finger1537 – 156125C2H2-type 14; degenerate
Zinc finger1567 – 158923C2H2-type 15
Zinc finger1595 – 161824C2H2-type 16
Zinc finger1628 – 165023C2H2-type 17
Zinc finger1656 – 168025C2H2-type 18
Zinc finger1686 – 170823C2H2-type 19
Zinc finger1714 – 173623C2H2-type 20
Zinc finger1742 – 176726C2H2-type 21
Zinc finger1773 – 179624C2H2-type 22

Natural variations

Alternative sequence1625 – 166036ERKFT…FKCTW → ERVKVAYRKIGTLPGIQNNR NASSASEAQSLCEHFS in isoform 3.
VSP_028843
Alternative sequence1661 – 2248588Missing in isoform 3.
VSP_028844
Alternative sequence1811 – 18155IVSKS → KGQKL in isoform 2.
VSP_028845
Alternative sequence1816 – 2248433Missing in isoform 2.
VSP_028846
Natural variant691N → S.
Corresponds to variant rs3794942 [ dbSNP | Ensembl ].
VAR_052820
Natural variant5121G → R.
Corresponds to variant rs7227263 [ dbSNP | Ensembl ].
VAR_052821
Natural variant9721N → T.
Corresponds to variant rs948615 [ dbSNP | Ensembl ].
VAR_036694
Natural variant12591S → L.
Corresponds to variant rs34048449 [ dbSNP | Ensembl ].
VAR_061945
Natural variant19131A → T.
Corresponds to variant rs17056248 [ dbSNP | Ensembl ].
VAR_052822

Experimental info

Sequence conflict9881K → E in BAA91077. Ref.2
Sequence conflict12971V → D in BAA91077. Ref.2
Sequence conflict13531F → S in BAA91077. Ref.2
Sequence conflict14151R → C in BAA91077. Ref.2
Sequence conflict15201I → V in BAA91077. Ref.2
Sequence conflict15841N → D in BAA91080. Ref.2
Sequence conflict21811D → G in AK023901. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 23, 2007. Version 2.
Checksum: 1AE958917F5F7B91

FASTA2,248247,367
        10         20         30         40         50         60 
MMDSENKPEN DEDEKINKEA QDLTKLSSHN EDGGPVSDVI ASFPENSMGK RGFSESSNSD 

        70         80         90        100        110        120 
SVVIGEDRNK HASKRRKLDE AEPLKSGKQG ICRLETSESS VTEGGIALDE TGKETFLSDC 

       130        140        150        160        170        180 
TVGGTCLPNA LSPSCNFSTI DVVSLKTDTE KTSAQEMVSL DLERESPFPP KEISVSCTIG 

       190        200        210        220        230        240 
NVDTVLKCSI CGHLFSSCSD LEKHAESHMQ QPKEHTCCHC SHKAESSSAL HMHIKQAHGP 

       250        260        270        280        290        300 
QKVFSCDLCG FQCSEENLLN AHYLGKTHLR RQNLAARGGF VQILTKQPFP KKSRTMATKN 

       310        320        330        340        350        360 
VHSKPRTSKS IAKNSDSKGL RNVGSTFKDF RGSISKQSGS SSELLVEMMP SRNTLSQEVE 

       370        380        390        400        410        420 
IVEEHVTSLG LAQNPENQSR KLDTLVTSEG LLEKLESTKN TLQAAHGNSV TSRPRPERNI 

       430        440        450        460        470        480 
LVLGNSFRRR SSTFTLKGQA KKRFNLLGIK RGTSETQRMY MKHLRTQMKT HDAESVLKHL 

       490        500        510        520        530        540 
EACSSVQRVC VTTSETQEAE QGQGSARPPD SGLHSLTVKP ASGSQTLCAC TDCGQVATNR 

       550        560        570        580        590        600 
TDLEIHVKRC HAREMKFYCR TCDFSSMSRR DLDEHLHSNQ HQQTASVLSC QCCSFISLDE 

       610        620        630        640        650        660 
INLRDHMKEK HNMHFLCTPC NLFFLSEKDV EEHKATEKHI NSLVQPKTLQ SSNSDLVLQT 

       670        680        690        700        710        720 
LPLSTLESEN AKESMDDSGK ASQEEPLKSR VSHGNEVRHS SKPQFQCKKC FYKTRSSTVL 

       730        740        750        760        770        780 
TRHIKLRHGQ DYHFLCKACN LYSLSKEGME KHIKRSKHLE NAKKNNIGLS FEECIERVCI 

       790        800        810        820        830        840 
GANDKKEEFD VSGNGRIEGH IGVQLQEHSY LEKGMLASEE LSQSGGSTKD DELASTTTPK 

       850        860        870        880        890        900 
RGRPKGNISR TCSHCGLLAS SITNLTVHIR RKHSHQYSYL CKVCKYYTVT KGDMERHCAT 

       910        920        930        940        950        960 
KKHKGRVEIE ASGKHSSDII VGPEGGSLEA GKKNAGSAVT MSDEHANKPA ESPTSVLEKP 

       970        980        990       1000       1010       1020 
DRGNSIEAEV ENVFHSLDGE VNSHLLDKKE QISSEPEDFA QPGDVYSQRD VTGTGENKCL 

      1030       1040       1050       1060       1070       1080 
HCEFSAHSSA SLELHVKRKH TKEFEFYCMA CDYYAVTRRE MTRHAATEKH KMKRQSYLNS 

      1090       1100       1110       1120       1130       1140 
ANVEAGSADM SKNIIMPEEE HQQNSEEFQI ISGQPSDTLK SRNAADCSIL NENTNLDMSK 

      1150       1160       1170       1180       1190       1200 
VLCAADSVEV ETEEESNFNE DHSFCETFQQ APVKDKVRKP EEMMSLTMSS NYGSPSRFQN 

      1210       1220       1230       1240       1250       1260 
ENSGSSALNC ETAKKNHEIS NDAGELRVHC EGEGGNAGDG GGVVPHRHLC PVTLDGERSA 

      1270       1280       1290       1300       1310       1320 
ESPVLVVTRI TREQGNLESG GQNRVARGHG LEDLKGVQED PVLGNKEILM NSQHETEFIL 

      1330       1340       1350       1360       1370       1380 
EEDGPASDST VESSDVYETI ISIDDKGQAM YSFGRFDSSI IRIKNPEDGE LIDQSEEGLI 

      1390       1400       1410       1420       1430       1440 
ATGVRISELP LKDCAQGVKK KKSEGSSIGE STRIRCDDCG FLADGLSGLN VHIAMKHPTK 

      1450       1460       1470       1480       1490       1500 
EKHFHCLLCG KSFYTESNLH QHLASAGHMR NEQASVEELP EGGATFKCVK CTEPFDSEQN 

      1510       1520       1530       1540       1550       1560 
LFLHIKGQHE ELLREVNKYI VEDTEQINRE REENQGNVCK YCGKMCRSSN SMAFLAHIRT 

      1570       1580       1590       1600       1610       1620 
HTGSKPFKCK ICHFATAQLG DARNHVKRHL GMREYKCHVC GVAFVMKKHL NTHLLGKHGV 

      1630       1640       1650       1660       1670       1680 
GTPKERKFTC HLCDRSFTEK WALNNHMKLH TGEKPFKCTW PTCHYSFLTA SAMKDHYRTH 

      1690       1700       1710       1720       1730       1740 
TGEKSFLCDL CGFAGGTRHA LTKHRRQHTG EKPFKCDECN FASTTQSHLT RHKRVHTGEK 

      1750       1760       1770       1780       1790       1800 
PYRCPWCDYR SNCAENIRKH ILHTGKHEGV KMYNCPKCDY GTNVPVEFRN HLKEQHPDIE 

      1810       1820       1830       1840       1850       1860 
NPDLAYLHAG IVSKSYECRL KGQGATFVET DSPFTAAALA EEPLVKEKPL RSSRRPAPPP 

      1870       1880       1890       1900       1910       1920 
EQVQQVIIFQ GYDGEFALDP SVEETAAATL QTLAMAGQVA RVVHITEDGQ VIATSQSGAH 

      1930       1940       1950       1960       1970       1980 
VGSVVPGPIL PEQLADGATQ VVVVGGSMEG HGMDESLSPG GAVIQQVTKQ EILNLSEAGV 

      1990       2000       2010       2020       2030       2040 
APPEASSALD ALLCAVTELG EVEGRAGLEE QGRPGAKDVL IQLPGQEVSH VAADPEAPEI 

      2050       2060       2070       2080       2090       2100 
QMFPQAQESP AAVEVLTQVV HPSAAMASQE RAQVAFKKMV QGVLQFAVCD TAAAGQLVKD 

      2110       2120       2130       2140       2150       2160 
GVTQVVVSEE GAVHMVAGEG AQIIMQEAQG EHMDLVESDG EISQIIVTEE LVQAMVQESS 

      2170       2180       2190       2200       2210       2220 
GGFSEGTTHY ILTELPPGVQ DEPGLYSHTV LETADSQELL QAGATLGTEA GAPSRAEQLA 

      2230       2240 
SVVIYTQEGS SAAAAIQSQR ESSELQEA 

« Hide

Isoform 2 [UniParc].

Checksum: 4C5D56BA3F87F5FD
Show »

FASTA1,815202,418
Isoform 3 [UniParc].

Checksum: 8A585EBEA30D9E8D
Show »

FASTA1,660184,081

References

[1]"DNA sequence and analysis of human chromosome 18."
Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. expand/collapse author list , Cook A., DeCaprio D., Engels R., Garber M., Gnirke A., Hafez N., Hall J.L., Norman C.H., Itoh T., Jaffe D.B., Kuroki Y., Lehoczky J., Lui A., Macdonald P., Mauceli E., Mikkelsen T.S., Naylor J.W., Nicol R., Nguyen C., Noguchi H., O'Leary S.B., Piqani B., Smith C.L., Talamas J.A., Topham K., Totoki Y., Toyoda A., Wain H.M., Young S.K., Zeng Q., Zimmer A.R., Fujiyama A., Hattori M., Birren B.W., Sakaki Y., Lander E.S.
Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-784 AND 1998-2248 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 774-2248 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1124-2248 (ISOFORM 3).
Tissue: Hepatoma, Teratocarcinoma and Thyroid.
[3]"Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1084-2248 (ISOFORM 1).
Tissue: Brain.
[4]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC138660 Genomic DNA. No translation available.
AC091589 Genomic DNA. No translation available.
AC023380 Genomic DNA. No translation available.
AC100783 Genomic DNA. No translation available.
AC015819 Genomic DNA. No translation available.
AK000314 mRNA. Translation: BAA91077.1. Different initiation.
AK000317 mRNA. Translation: BAA91080.1. Different initiation.
AK023901 mRNA. No translation available.
AK056288 mRNA. Translation: BAB71139.1.
AB051490 mRNA. Translation: BAB21794.1.
CCDSCCDS45885.1. [Q9C0G0-1]
CCDS54191.1. [Q9C0G0-3]
CCDS58634.1. [Q9C0G0-2]
RefSeqNP_001139661.1. NM_001146189.1. [Q9C0G0-2]
NP_001139662.1. NM_001146190.1. [Q9C0G0-3]
NP_060227.2. NM_017757.2. [Q9C0G0-1]
XP_005266783.1. XM_005266726.2. [Q9C0G0-1]
UniGeneHs.536490.

3D structure databases

ProteinModelPortalQ9C0G0.
SMRQ9C0G0. Positions 203-250, 528-642, 702-754, 850-902, 1412-1796.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120767. 6 interactions.
IntActQ9C0G0. 1 interaction.

PTM databases

PhosphoSiteQ9C0G0.

Polymorphism databases

DMDM160358927.

Proteomic databases

MaxQBQ9C0G0.
PaxDbQ9C0G0.
PRIDEQ9C0G0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000299687; ENSP00000299687; ENSG00000215421. [Q9C0G0-1]
ENST00000309902; ENSP00000310359; ENSG00000215421. [Q9C0G0-3]
ENST00000577538; ENSP00000463270; ENSG00000215421. [Q9C0G0-2]
ENST00000582337; ENSP00000462348; ENSG00000215421. [Q9C0G0-3]
GeneID55628.
KEGGhsa:55628.
UCSCuc002llu.2. human. [Q9C0G0-1]
uc010dqu.2. human. [Q9C0G0-2]
uc010xfc.2. human. [Q9C0G0-3]

Organism-specific databases

CTD55628.
GeneCardsGC18P072345.
HGNCHGNC:19904. ZNF407.
HPAHPA028255.
neXtProtNX_Q9C0G0.
PharmGKBPA134942906.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000155792.
HOVERGENHBG108768.
InParanoidQ9C0G0.
OMANQHQQTA.
OrthoDBEOG74R1PR.
PhylomeDBQ9C0G0.
TreeFamTF350895.

Gene expression databases

BgeeQ9C0G0.
CleanExHS_ZNF407.
GenevestigatorQ9C0G0.

Family and domain databases

Gene3D3.30.160.60. 7 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
IPR003604. Znf_U1.
[Graphical view]
PfamPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 25 hits.
SM00451. ZnF_U1. 7 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSZNF407. human.
GenomeRNAi55628.
NextBio60257.
PROQ9C0G0.

Entry information

Entry nameZN407_HUMAN
AccessionPrimary (citable) accession number: Q9C0G0
Secondary accession number(s): B5MD54 expand/collapse secondary AC list , Q96MY0, Q9H8A1, Q9NXD4, Q9NXD7
Entry history
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 18

Human chromosome 18: entries, gene names and cross-references to MIM