Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9C0G0

- ZN407_HUMAN

UniProt

Q9C0G0 - ZN407_HUMAN

Protein

Zinc finger protein 407

Gene

ZNF407

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 2 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri186 – 20823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri215 – 23824C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri244 – 26825C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri528 – 55124C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri557 – 58125C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri615 – 63925C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri705 – 72824C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri850 – 87324C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri879 – 90325C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1017 – 104024C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1046 – 107025C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1444 – 146825C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1486 – 150924C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1537 – 156125C2H2-type 14; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1567 – 158923C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1595 – 161824C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1628 – 165023C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1656 – 168025C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1686 – 170823C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1714 – 173623C2H2-type 20PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1742 – 176726C2H2-type 21PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1773 – 179624C2H2-type 22PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 407
    Gene namesi
    Name:ZNF407
    Synonyms:KIAA1703
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:19904. ZNF407.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134942906.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 22482248Zinc finger protein 407PRO_0000047568Add
    BLAST

    Proteomic databases

    MaxQBiQ9C0G0.
    PaxDbiQ9C0G0.
    PRIDEiQ9C0G0.

    PTM databases

    PhosphoSiteiQ9C0G0.

    Expressioni

    Gene expression databases

    BgeeiQ9C0G0.
    CleanExiHS_ZNF407.
    GenevestigatoriQ9C0G0.

    Organism-specific databases

    HPAiHPA028255.

    Interactioni

    Protein-protein interaction databases

    BioGridi120767. 6 interactions.
    IntActiQ9C0G0. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9C0G0.
    SMRiQ9C0G0. Positions 203-250, 528-642, 702-754, 850-902, 1412-1796.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Contains 22 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri186 – 20823C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri215 – 23824C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri244 – 26825C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri528 – 55124C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri557 – 58125C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri615 – 63925C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri705 – 72824C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri850 – 87324C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri879 – 90325C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1017 – 104024C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1046 – 107025C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1444 – 146825C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1486 – 150924C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1537 – 156125C2H2-type 14; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1567 – 158923C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1595 – 161824C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1628 – 165023C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1656 – 168025C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1686 – 170823C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1714 – 173623C2H2-type 20PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1742 – 176726C2H2-type 21PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1773 – 179624C2H2-type 22PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000155792.
    HOVERGENiHBG108768.
    InParanoidiQ9C0G0.
    OMAiNQHQQTA.
    OrthoDBiEOG74R1PR.
    PhylomeDBiQ9C0G0.
    TreeFamiTF350895.

    Family and domain databases

    Gene3Di3.30.160.60. 7 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    IPR003604. Znf_U1.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 25 hits.
    SM00451. ZnF_U1. 7 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
    PS50157. ZINC_FINGER_C2H2_2. 9 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9C0G0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMDSENKPEN DEDEKINKEA QDLTKLSSHN EDGGPVSDVI ASFPENSMGK     50
    RGFSESSNSD SVVIGEDRNK HASKRRKLDE AEPLKSGKQG ICRLETSESS 100
    VTEGGIALDE TGKETFLSDC TVGGTCLPNA LSPSCNFSTI DVVSLKTDTE 150
    KTSAQEMVSL DLERESPFPP KEISVSCTIG NVDTVLKCSI CGHLFSSCSD 200
    LEKHAESHMQ QPKEHTCCHC SHKAESSSAL HMHIKQAHGP QKVFSCDLCG 250
    FQCSEENLLN AHYLGKTHLR RQNLAARGGF VQILTKQPFP KKSRTMATKN 300
    VHSKPRTSKS IAKNSDSKGL RNVGSTFKDF RGSISKQSGS SSELLVEMMP 350
    SRNTLSQEVE IVEEHVTSLG LAQNPENQSR KLDTLVTSEG LLEKLESTKN 400
    TLQAAHGNSV TSRPRPERNI LVLGNSFRRR SSTFTLKGQA KKRFNLLGIK 450
    RGTSETQRMY MKHLRTQMKT HDAESVLKHL EACSSVQRVC VTTSETQEAE 500
    QGQGSARPPD SGLHSLTVKP ASGSQTLCAC TDCGQVATNR TDLEIHVKRC 550
    HAREMKFYCR TCDFSSMSRR DLDEHLHSNQ HQQTASVLSC QCCSFISLDE 600
    INLRDHMKEK HNMHFLCTPC NLFFLSEKDV EEHKATEKHI NSLVQPKTLQ 650
    SSNSDLVLQT LPLSTLESEN AKESMDDSGK ASQEEPLKSR VSHGNEVRHS 700
    SKPQFQCKKC FYKTRSSTVL TRHIKLRHGQ DYHFLCKACN LYSLSKEGME 750
    KHIKRSKHLE NAKKNNIGLS FEECIERVCI GANDKKEEFD VSGNGRIEGH 800
    IGVQLQEHSY LEKGMLASEE LSQSGGSTKD DELASTTTPK RGRPKGNISR 850
    TCSHCGLLAS SITNLTVHIR RKHSHQYSYL CKVCKYYTVT KGDMERHCAT 900
    KKHKGRVEIE ASGKHSSDII VGPEGGSLEA GKKNAGSAVT MSDEHANKPA 950
    ESPTSVLEKP DRGNSIEAEV ENVFHSLDGE VNSHLLDKKE QISSEPEDFA 1000
    QPGDVYSQRD VTGTGENKCL HCEFSAHSSA SLELHVKRKH TKEFEFYCMA 1050
    CDYYAVTRRE MTRHAATEKH KMKRQSYLNS ANVEAGSADM SKNIIMPEEE 1100
    HQQNSEEFQI ISGQPSDTLK SRNAADCSIL NENTNLDMSK VLCAADSVEV 1150
    ETEEESNFNE DHSFCETFQQ APVKDKVRKP EEMMSLTMSS NYGSPSRFQN 1200
    ENSGSSALNC ETAKKNHEIS NDAGELRVHC EGEGGNAGDG GGVVPHRHLC 1250
    PVTLDGERSA ESPVLVVTRI TREQGNLESG GQNRVARGHG LEDLKGVQED 1300
    PVLGNKEILM NSQHETEFIL EEDGPASDST VESSDVYETI ISIDDKGQAM 1350
    YSFGRFDSSI IRIKNPEDGE LIDQSEEGLI ATGVRISELP LKDCAQGVKK 1400
    KKSEGSSIGE STRIRCDDCG FLADGLSGLN VHIAMKHPTK EKHFHCLLCG 1450
    KSFYTESNLH QHLASAGHMR NEQASVEELP EGGATFKCVK CTEPFDSEQN 1500
    LFLHIKGQHE ELLREVNKYI VEDTEQINRE REENQGNVCK YCGKMCRSSN 1550
    SMAFLAHIRT HTGSKPFKCK ICHFATAQLG DARNHVKRHL GMREYKCHVC 1600
    GVAFVMKKHL NTHLLGKHGV GTPKERKFTC HLCDRSFTEK WALNNHMKLH 1650
    TGEKPFKCTW PTCHYSFLTA SAMKDHYRTH TGEKSFLCDL CGFAGGTRHA 1700
    LTKHRRQHTG EKPFKCDECN FASTTQSHLT RHKRVHTGEK PYRCPWCDYR 1750
    SNCAENIRKH ILHTGKHEGV KMYNCPKCDY GTNVPVEFRN HLKEQHPDIE 1800
    NPDLAYLHAG IVSKSYECRL KGQGATFVET DSPFTAAALA EEPLVKEKPL 1850
    RSSRRPAPPP EQVQQVIIFQ GYDGEFALDP SVEETAAATL QTLAMAGQVA 1900
    RVVHITEDGQ VIATSQSGAH VGSVVPGPIL PEQLADGATQ VVVVGGSMEG 1950
    HGMDESLSPG GAVIQQVTKQ EILNLSEAGV APPEASSALD ALLCAVTELG 2000
    EVEGRAGLEE QGRPGAKDVL IQLPGQEVSH VAADPEAPEI QMFPQAQESP 2050
    AAVEVLTQVV HPSAAMASQE RAQVAFKKMV QGVLQFAVCD TAAAGQLVKD 2100
    GVTQVVVSEE GAVHMVAGEG AQIIMQEAQG EHMDLVESDG EISQIIVTEE 2150
    LVQAMVQESS GGFSEGTTHY ILTELPPGVQ DEPGLYSHTV LETADSQELL 2200
    QAGATLGTEA GAPSRAEQLA SVVIYTQEGS SAAAAIQSQR ESSELQEA 2248
    Length:2,248
    Mass (Da):247,367
    Last modified:October 23, 2007 - v2
    Checksum:i1AE958917F5F7B91
    GO
    Isoform 2 (identifier: Q9C0G0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1811-1815: IVSKS → KGQKL
         1816-2248: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,815
    Mass (Da):202,418
    Checksum:i4C5D56BA3F87F5FD
    GO
    Isoform 3 (identifier: Q9C0G0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1625-1660: ERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTW → ERVKVAYRKIGTLPGIQNNRNASSASEAQSLCEHFS
         1661-2248: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,660
    Mass (Da):184,081
    Checksum:i8A585EBEA30D9E8D
    GO

    Sequence cautioni

    The sequence BAA91077.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA91080.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti988 – 9881K → E in BAA91077. (PubMed:14702039)Curated
    Sequence conflicti1297 – 12971V → D in BAA91077. (PubMed:14702039)Curated
    Sequence conflicti1353 – 13531F → S in BAA91077. (PubMed:14702039)Curated
    Sequence conflicti1415 – 14151R → C in BAA91077. (PubMed:14702039)Curated
    Sequence conflicti1520 – 15201I → V in BAA91077. (PubMed:14702039)Curated
    Sequence conflicti1584 – 15841N → D in BAA91080. (PubMed:14702039)Curated
    Sequence conflicti2181 – 21811D → G in AK023901. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti69 – 691N → S.
    Corresponds to variant rs3794942 [ dbSNP | Ensembl ].
    VAR_052820
    Natural varianti512 – 5121G → R.
    Corresponds to variant rs7227263 [ dbSNP | Ensembl ].
    VAR_052821
    Natural varianti972 – 9721N → T.
    Corresponds to variant rs948615 [ dbSNP | Ensembl ].
    VAR_036694
    Natural varianti1259 – 12591S → L.
    Corresponds to variant rs34048449 [ dbSNP | Ensembl ].
    VAR_061945
    Natural varianti1913 – 19131A → T.
    Corresponds to variant rs17056248 [ dbSNP | Ensembl ].
    VAR_052822

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1625 – 166036ERKFT…FKCTW → ERVKVAYRKIGTLPGIQNNR NASSASEAQSLCEHFS in isoform 3. 1 PublicationVSP_028843Add
    BLAST
    Alternative sequencei1661 – 2248588Missing in isoform 3. 1 PublicationVSP_028844Add
    BLAST
    Alternative sequencei1811 – 18155IVSKS → KGQKL in isoform 2. 1 PublicationVSP_028845
    Alternative sequencei1816 – 2248433Missing in isoform 2. 1 PublicationVSP_028846Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC138660 Genomic DNA. No translation available.
    AC091589 Genomic DNA. No translation available.
    AC023380 Genomic DNA. No translation available.
    AC100783 Genomic DNA. No translation available.
    AC015819 Genomic DNA. No translation available.
    AK000314 mRNA. Translation: BAA91077.1. Different initiation.
    AK000317 mRNA. Translation: BAA91080.1. Different initiation.
    AK023901 mRNA. No translation available.
    AK056288 mRNA. Translation: BAB71139.1.
    AB051490 mRNA. Translation: BAB21794.1.
    CCDSiCCDS45885.1. [Q9C0G0-1]
    CCDS54191.1. [Q9C0G0-3]
    CCDS58634.1. [Q9C0G0-2]
    RefSeqiNP_001139661.1. NM_001146189.1. [Q9C0G0-2]
    NP_001139662.1. NM_001146190.1. [Q9C0G0-3]
    NP_060227.2. NM_017757.2. [Q9C0G0-1]
    XP_005266783.1. XM_005266726.2. [Q9C0G0-1]
    UniGeneiHs.536490.

    Genome annotation databases

    EnsembliENST00000299687; ENSP00000299687; ENSG00000215421. [Q9C0G0-1]
    ENST00000309902; ENSP00000310359; ENSG00000215421. [Q9C0G0-3]
    ENST00000577538; ENSP00000463270; ENSG00000215421. [Q9C0G0-2]
    ENST00000582337; ENSP00000462348; ENSG00000215421. [Q9C0G0-3]
    GeneIDi55628.
    KEGGihsa:55628.
    UCSCiuc002llu.2. human. [Q9C0G0-1]
    uc010dqu.2. human. [Q9C0G0-2]
    uc010xfc.2. human. [Q9C0G0-3]

    Polymorphism databases

    DMDMi160358927.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC138660 Genomic DNA. No translation available.
    AC091589 Genomic DNA. No translation available.
    AC023380 Genomic DNA. No translation available.
    AC100783 Genomic DNA. No translation available.
    AC015819 Genomic DNA. No translation available.
    AK000314 mRNA. Translation: BAA91077.1 . Different initiation.
    AK000317 mRNA. Translation: BAA91080.1 . Different initiation.
    AK023901 mRNA. No translation available.
    AK056288 mRNA. Translation: BAB71139.1 .
    AB051490 mRNA. Translation: BAB21794.1 .
    CCDSi CCDS45885.1. [Q9C0G0-1 ]
    CCDS54191.1. [Q9C0G0-3 ]
    CCDS58634.1. [Q9C0G0-2 ]
    RefSeqi NP_001139661.1. NM_001146189.1. [Q9C0G0-2 ]
    NP_001139662.1. NM_001146190.1. [Q9C0G0-3 ]
    NP_060227.2. NM_017757.2. [Q9C0G0-1 ]
    XP_005266783.1. XM_005266726.2. [Q9C0G0-1 ]
    UniGenei Hs.536490.

    3D structure databases

    ProteinModelPortali Q9C0G0.
    SMRi Q9C0G0. Positions 203-250, 528-642, 702-754, 850-902, 1412-1796.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120767. 6 interactions.
    IntActi Q9C0G0. 1 interaction.

    PTM databases

    PhosphoSitei Q9C0G0.

    Polymorphism databases

    DMDMi 160358927.

    Proteomic databases

    MaxQBi Q9C0G0.
    PaxDbi Q9C0G0.
    PRIDEi Q9C0G0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000299687 ; ENSP00000299687 ; ENSG00000215421 . [Q9C0G0-1 ]
    ENST00000309902 ; ENSP00000310359 ; ENSG00000215421 . [Q9C0G0-3 ]
    ENST00000577538 ; ENSP00000463270 ; ENSG00000215421 . [Q9C0G0-2 ]
    ENST00000582337 ; ENSP00000462348 ; ENSG00000215421 . [Q9C0G0-3 ]
    GeneIDi 55628.
    KEGGi hsa:55628.
    UCSCi uc002llu.2. human. [Q9C0G0-1 ]
    uc010dqu.2. human. [Q9C0G0-2 ]
    uc010xfc.2. human. [Q9C0G0-3 ]

    Organism-specific databases

    CTDi 55628.
    GeneCardsi GC18P072345.
    HGNCi HGNC:19904. ZNF407.
    HPAi HPA028255.
    neXtProti NX_Q9C0G0.
    PharmGKBi PA134942906.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000155792.
    HOVERGENi HBG108768.
    InParanoidi Q9C0G0.
    OMAi NQHQQTA.
    OrthoDBi EOG74R1PR.
    PhylomeDBi Q9C0G0.
    TreeFami TF350895.

    Miscellaneous databases

    ChiTaRSi ZNF407. human.
    GenomeRNAii 55628.
    NextBioi 60257.
    PROi Q9C0G0.

    Gene expression databases

    Bgeei Q9C0G0.
    CleanExi HS_ZNF407.
    Genevestigatori Q9C0G0.

    Family and domain databases

    Gene3Di 3.30.160.60. 7 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    IPR003604. Znf_U1.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 25 hits.
    SM00451. ZnF_U1. 7 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 8 hits.
    PS50157. ZINC_FINGER_C2H2_2. 9 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-784 AND 1998-2248 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 774-2248 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1124-2248 (ISOFORM 3).
      Tissue: Hepatoma, Teratocarcinoma and Thyroid.
    3. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
      DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1084-2248 (ISOFORM 1).
      Tissue: Brain.
    4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.

    Entry informationi

    Entry nameiZN407_HUMAN
    AccessioniPrimary (citable) accession number: Q9C0G0
    Secondary accession number(s): B5MD54
    , Q96MY0, Q9H8A1, Q9NXD4, Q9NXD7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2003
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 104 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3