Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 44 kDa

Gene

CEP44

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 44 kDa
Short name:
Cep44
Alternative name(s):
HBV PreS1-transactivated protein 3
Short name:
PS1TP3
Gene namesi
Name:CEP44
Synonyms:KIAA1712
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:29356. CEP44.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: UniProtKB-KW
  • midbody Source: UniProtKB
  • spindle pole Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134933992.

Polymorphism and mutation databases

BioMutaiCEP44.
DMDMi152032537.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 390390Centrosomal protein of 44 kDaPRO_0000293722Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei331 – 3311PhosphoserineCombined sources
Modified residuei345 – 3451PhosphoserineCombined sources
Modified residuei346 – 3461PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9C0F1.
MaxQBiQ9C0F1.
PaxDbiQ9C0F1.
PeptideAtlasiQ9C0F1.
PRIDEiQ9C0F1.

PTM databases

iPTMnetiQ9C0F1.
PhosphoSiteiQ9C0F1.

Expressioni

Gene expression databases

BgeeiENSG00000164118.
CleanExiHS_KIAA1712.
ExpressionAtlasiQ9C0F1. baseline and differential.
GenevisibleiQ9C0F1. HS.

Organism-specific databases

HPAiHPA041515.
HPA041835.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ABI3Q9P2A44EBI-744115,EBI-742038
AQP1P299723EBI-744115,EBI-745213
BEND7Q8N7W2-23EBI-744115,EBI-10181188
BYSLQ138955EBI-744115,EBI-358049
CCDC146Q8IYE0-23EBI-744115,EBI-10247802
CDC23Q9UJX23EBI-744115,EBI-396137
CEP57L1Q8IYX8-23EBI-744115,EBI-10181988
CHIC2Q9UKJ53EBI-744115,EBI-741528
DHX57Q6P1583EBI-744115,EBI-1051531
DIP2AQ146893EBI-744115,EBI-2564275
ERAL1O756163EBI-744115,EBI-6393536
FAM161AQ3B8203EBI-744115,EBI-719941
FAM74A6Q5TZK33EBI-744115,EBI-10247271
FXR2P511163EBI-744115,EBI-740459
GNG11Q53Y013EBI-744115,EBI-10243023
HAUS1Q96CS24EBI-744115,EBI-2514791
HYPMO754093EBI-744115,EBI-6447217
ING5Q8WYH83EBI-744115,EBI-488533
LMO1P258003EBI-744115,EBI-8639312
LRRFIP1Q32MZ4-43EBI-744115,EBI-10240044
MAPK9P459844EBI-744115,EBI-713568
MGC24125Q8NEQ23EBI-744115,EBI-10270788
MLLT6Q6P2C63EBI-744115,EBI-5773143
MRFAP1L1Q96HT83EBI-744115,EBI-748896
NAA10P412273EBI-744115,EBI-747693
PLEKHF2Q9H8W43EBI-744115,EBI-742388
POP5Q969H63EBI-744115,EBI-366525
PSMD3O432423EBI-744115,EBI-357622
RBM15Q96T373EBI-744115,EBI-2514922
SCNM1Q9BWG63EBI-744115,EBI-748391
SPERTQ8NA614EBI-744115,EBI-741724
TCEA2Q155603EBI-744115,EBI-710310
TRIM41Q8WV443EBI-744115,EBI-725997
TSGA10Q9BZW73EBI-744115,EBI-744794
TXLNAP402223EBI-744115,EBI-359793
ZFYVE26Q96H433EBI-744115,EBI-10286915
ZNF417Q8TAU34EBI-744115,EBI-740727
ZNF587Q96SQ53EBI-744115,EBI-6427977

Protein-protein interaction databases

BioGridi123315. 137 interactions.
IntActiQ9C0F1. 126 interactions.
MINTiMINT-1459822.
STRINGi9606.ENSP00000389427.

Structurei

3D structure databases

ProteinModelPortaliQ9C0F1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili233 – 26937Sequence analysisAdd
BLAST
Coiled coili361 – 38525Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEHB. Eukaryota.
ENOG4111F5M. LUCA.
GeneTreeiENSGT00390000009873.
HOGENOMiHOG000015329.
HOVERGENiHBG101789.
InParanoidiQ9C0F1.
KOiK16761.
OMAiQTMLAEC.
OrthoDBiEOG091G0EI4.
PhylomeDBiQ9C0F1.
TreeFamiTF332994.

Family and domain databases

InterProiIPR033603. CEP44.
IPR029157. CEP44_CC.
[Graphical view]
PANTHERiPTHR31477. PTHR31477. 1 hit.
PfamiPF15007. CEP44. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATGDLKRSL RNLEQVLRLL NYPEEVDCVG LIKGDPAASL PIISYSFTSY
60 70 80 90 100
SPYVTELIME SNVELIAKND LRFIDAVYKL LRDQFNYKPI LTKKQFIQCG
110 120 130 140 150
FAEWKIQIVC DILNCVMKKH KELSSLQKIP SQQRKKISSG KSEPPLGNEK
160 170 180 190 200
ISAEAVGVDI SGRFMTSGKK KAVVIRHLYN EDNVDISEDT LSPITDVNEA
210 220 230 240 250
VDVSDLNATE IKMPEVKVPE IKAEQQDVNV NPEITALQTM LAECQENLKK
260 270 280 290 300
LTSIEKRLDC LEQKMKGKVM VDENTWTNLL SRVTLLETEM LLSKKNDEFI
310 320 330 340 350
EFNEVSEDYA SCSDMDLLNP HRKSEVERPA SIPLSSGYST ASSDSTPRAS
360 370 380 390
TVNYCGLNEI SEETTIQKME RMKKMFEETA ELLKCPNHYL
Length:390
Mass (Da):44,140
Last modified:July 10, 2007 - v2
Checksum:i5B917C1159B1B7E2
GO
Isoform 2 (identifier: Q9C0F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-390: ETTIQKMERMKKMFEETAELLKCPNHYL → NFPAWSATSSCSSLSWLLRGHTSYLSSQSFAWPLSCV

Show »
Length:399
Mass (Da):44,762
Checksum:iE9B38E9A9C7ECED9
GO

Sequence cautioni

The sequence BAB21803 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti147 – 1471G → S.2 Publications
Corresponds to variant rs4695918 [ dbSNP | Ensembl ].
VAR_033116

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei363 – 39028ETTIQ…PNHYL → NFPAWSATSSCSSLSWLLRG HTSYLSSQSFAWPLSCV in isoform 2. 1 PublicationVSP_041378Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA. Translation: AAR88428.1.
AB051499 mRNA. Translation: BAB21803.1. Different initiation.
AK094961 mRNA. Translation: BAG52965.1.
AK292484 mRNA. Translation: BAF85173.1.
AC097653 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04738.1.
CH471056 Genomic DNA. Translation: EAX04739.1.
CH471056 Genomic DNA. Translation: EAX04740.1.
BC038667 mRNA. Translation: AAH38667.1.
CCDSiCCDS34106.1. [Q9C0F1-1]
CCDS47163.1. [Q9C0F1-2]
RefSeqiNP_001035247.1. NM_001040157.2. [Q9C0F1-1]
NP_001138786.1. NM_001145314.1. [Q9C0F1-2]
XP_011530587.1. XM_011532285.2. [Q9C0F1-2]
XP_011530588.1. XM_011532286.2. [Q9C0F1-2]
XP_011530589.1. XM_011532287.2. [Q9C0F1-2]
UniGeneiHs.555989.

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118. [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118. [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118. [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118. [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118. [Q9C0F1-1]
GeneIDi80817.
KEGGihsa:80817.
UCSCiuc003itr.4. human. [Q9C0F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA. Translation: AAR88428.1.
AB051499 mRNA. Translation: BAB21803.1. Different initiation.
AK094961 mRNA. Translation: BAG52965.1.
AK292484 mRNA. Translation: BAF85173.1.
AC097653 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04738.1.
CH471056 Genomic DNA. Translation: EAX04739.1.
CH471056 Genomic DNA. Translation: EAX04740.1.
BC038667 mRNA. Translation: AAH38667.1.
CCDSiCCDS34106.1. [Q9C0F1-1]
CCDS47163.1. [Q9C0F1-2]
RefSeqiNP_001035247.1. NM_001040157.2. [Q9C0F1-1]
NP_001138786.1. NM_001145314.1. [Q9C0F1-2]
XP_011530587.1. XM_011532285.2. [Q9C0F1-2]
XP_011530588.1. XM_011532286.2. [Q9C0F1-2]
XP_011530589.1. XM_011532287.2. [Q9C0F1-2]
UniGeneiHs.555989.

3D structure databases

ProteinModelPortaliQ9C0F1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123315. 137 interactions.
IntActiQ9C0F1. 126 interactions.
MINTiMINT-1459822.
STRINGi9606.ENSP00000389427.

PTM databases

iPTMnetiQ9C0F1.
PhosphoSiteiQ9C0F1.

Polymorphism and mutation databases

BioMutaiCEP44.
DMDMi152032537.

Proteomic databases

EPDiQ9C0F1.
MaxQBiQ9C0F1.
PaxDbiQ9C0F1.
PeptideAtlasiQ9C0F1.
PRIDEiQ9C0F1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118. [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118. [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118. [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118. [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118. [Q9C0F1-1]
GeneIDi80817.
KEGGihsa:80817.
UCSCiuc003itr.4. human. [Q9C0F1-1]

Organism-specific databases

CTDi80817.
GeneCardsiCEP44.
H-InvDBHIX0004644.
HGNCiHGNC:29356. CEP44.
HPAiHPA041515.
HPA041835.
neXtProtiNX_Q9C0F1.
PharmGKBiPA134933992.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEHB. Eukaryota.
ENOG4111F5M. LUCA.
GeneTreeiENSGT00390000009873.
HOGENOMiHOG000015329.
HOVERGENiHBG101789.
InParanoidiQ9C0F1.
KOiK16761.
OMAiQTMLAEC.
OrthoDBiEOG091G0EI4.
PhylomeDBiQ9C0F1.
TreeFamiTF332994.

Miscellaneous databases

ChiTaRSiCEP44. human.
GenomeRNAii80817.
PROiQ9C0F1.

Gene expression databases

BgeeiENSG00000164118.
CleanExiHS_KIAA1712.
ExpressionAtlasiQ9C0F1. baseline and differential.
GenevisibleiQ9C0F1. HS.

Family and domain databases

InterProiIPR033603. CEP44.
IPR029157. CEP44_CC.
[Graphical view]
PANTHERiPTHR31477. PTHR31477. 1 hit.
PfamiPF15007. CEP44. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCEP44_HUMAN
AccessioniPrimary (citable) accession number: Q9C0F1
Secondary accession number(s): A8K8W9
, A8MW11, B3KT53, D3DP42, Q8IXZ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: September 7, 2016
This is version 95 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.