Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 44 kDa

Gene

CEP44

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 44 kDa
Short name:
Cep44
Alternative name(s):
HBV PreS1-transactivated protein 3
Short name:
PS1TP3
Gene namesi
Name:CEP44
Synonyms:KIAA1712
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164118.12.
HGNCiHGNC:29356. CEP44.
neXtProtiNX_Q9C0F1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000164118.
PharmGKBiPA134933992.

Polymorphism and mutation databases

BioMutaiCEP44.
DMDMi152032537.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002937221 – 390Centrosomal protein of 44 kDaAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei331PhosphoserineCombined sources1
Modified residuei345PhosphoserineCombined sources1
Modified residuei346PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9C0F1.
MaxQBiQ9C0F1.
PaxDbiQ9C0F1.
PeptideAtlasiQ9C0F1.
PRIDEiQ9C0F1.

PTM databases

iPTMnetiQ9C0F1.
PhosphoSitePlusiQ9C0F1.

Expressioni

Gene expression databases

BgeeiENSG00000164118.
CleanExiHS_KIAA1712.
ExpressionAtlasiQ9C0F1. baseline and differential.
GenevisibleiQ9C0F1. HS.

Organism-specific databases

HPAiHPA041515.
HPA041835.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ABI3Q9P2A46EBI-744115,EBI-742038
AQP1P299723EBI-744115,EBI-745213
BEND7Q8N7W2-23EBI-744115,EBI-10181188
BFSP2Q135154EBI-744115,EBI-10229433
BYSLQ138955EBI-744115,EBI-358049
CCDC146Q8IYE0-23EBI-744115,EBI-10247802
CDC23Q9UJX23EBI-744115,EBI-396137
CEP57L1Q8IYX8-23EBI-744115,EBI-10181988
CHIC2Q9UKJ53EBI-744115,EBI-741528
DCTN2Q135613EBI-744115,EBI-715074
DHX57Q6P1583EBI-744115,EBI-1051531
DIP2AQ146893EBI-744115,EBI-2564275
ERAL1O756163EBI-744115,EBI-6393536
FAM161AQ3B8203EBI-744115,EBI-719941
FAM74A6Q5TZK33EBI-744115,EBI-10247271
FXR2P511163EBI-744115,EBI-740459
GNG11Q53Y013EBI-744115,EBI-10243023
HAUS1Q96CS24EBI-744115,EBI-2514791
HYPMO754097EBI-744115,EBI-6447217
ING5Q8WYH83EBI-744115,EBI-488533
INH1P010973EBI-744115,EBI-8874From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
LMO1P258003EBI-744115,EBI-8639312
LRRFIP1Q32MZ4-43EBI-744115,EBI-10240044
MAPK9P459846EBI-744115,EBI-713568
MCRS1Q96EZ83EBI-744115,EBI-348259
MGC24125Q8NEQ23EBI-744115,EBI-10270788
MLLT6Q6P2C63EBI-744115,EBI-5773143
MRFAP1L1Q96HT83EBI-744115,EBI-748896
NAA10P412273EBI-744115,EBI-747693
PLEKHF2Q9H8W43EBI-744115,EBI-742388
POP5Q969H65EBI-744115,EBI-366525
PRP3Q033383EBI-744115,EBI-421From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
PSMD3O432423EBI-744115,EBI-357622
RBM15Q96T373EBI-744115,EBI-2514922
RNF8O760643EBI-744115,EBI-373337
SCNM1Q9BWG63EBI-744115,EBI-748391
SPERTQ8NA614EBI-744115,EBI-741724
TAE1P383403EBI-744115,EBI-21116From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
TCEA2Q155603EBI-744115,EBI-710310
TCP1P126123EBI-744115,EBI-19045From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
THI20Q082243EBI-744115,EBI-35298From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
TRIM41Q8WV443EBI-744115,EBI-725997
TSGA10Q9BZW75EBI-744115,EBI-744794
TXLNAP402225EBI-744115,EBI-359793
YJR011CP470863EBI-744115,EBI-26299From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
YLR108CQ122593EBI-744115,EBI-30776From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
YPL077CQ028313EBI-744115,EBI-31828From Saccharomyces cerevisiae (strain ATCC 204508 / S288c).
ZFYVE26Q68DK2-55EBI-744115,EBI-8656416
ZNF417Q8TAU34EBI-744115,EBI-740727
ZNF587Q96SQ55EBI-744115,EBI-6427977
ZNF688A0A0S2Z5X43EBI-744115,EBI-16429014

Protein-protein interaction databases

BioGridi123315. 147 interactors.
IntActiQ9C0F1. 146 interactors.
MINTiQ9C0F1.

Structurei

3D structure databases

ProteinModelPortaliQ9C0F1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili233 – 269Sequence analysisAdd BLAST37
Coiled coili361 – 385Sequence analysisAdd BLAST25

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEHB. Eukaryota.
ENOG4111F5M. LUCA.
GeneTreeiENSGT00390000009873.
HOGENOMiHOG000015329.
HOVERGENiHBG101789.
InParanoidiQ9C0F1.
KOiK16761.
OMAiQTMLAEC.
OrthoDBiEOG091G0EI4.
PhylomeDBiQ9C0F1.
TreeFamiTF332994.

Family and domain databases

InterProiView protein in InterPro
IPR033603. CEP44.
IPR029157. CEP44_CC.
PANTHERiPTHR31477. PTHR31477. 1 hit.
PfamiView protein in Pfam
PF15007. CEP44. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATGDLKRSL RNLEQVLRLL NYPEEVDCVG LIKGDPAASL PIISYSFTSY
60 70 80 90 100
SPYVTELIME SNVELIAKND LRFIDAVYKL LRDQFNYKPI LTKKQFIQCG
110 120 130 140 150
FAEWKIQIVC DILNCVMKKH KELSSLQKIP SQQRKKISSG KSEPPLGNEK
160 170 180 190 200
ISAEAVGVDI SGRFMTSGKK KAVVIRHLYN EDNVDISEDT LSPITDVNEA
210 220 230 240 250
VDVSDLNATE IKMPEVKVPE IKAEQQDVNV NPEITALQTM LAECQENLKK
260 270 280 290 300
LTSIEKRLDC LEQKMKGKVM VDENTWTNLL SRVTLLETEM LLSKKNDEFI
310 320 330 340 350
EFNEVSEDYA SCSDMDLLNP HRKSEVERPA SIPLSSGYST ASSDSTPRAS
360 370 380 390
TVNYCGLNEI SEETTIQKME RMKKMFEETA ELLKCPNHYL
Length:390
Mass (Da):44,140
Last modified:July 10, 2007 - v2
Checksum:i5B917C1159B1B7E2
GO
Isoform 2 (identifier: Q9C0F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-390: ETTIQKMERMKKMFEETAELLKCPNHYL → NFPAWSATSSCSSLSWLLRGHTSYLSSQSFAWPLSCV

Show »
Length:399
Mass (Da):44,762
Checksum:iE9B38E9A9C7ECED9
GO

Sequence cautioni

The sequence BAB21803 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033116147G → S2 PublicationsCorresponds to variant dbSNP:rs4695918Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041378363 – 390ETTIQ…PNHYL → NFPAWSATSSCSSLSWLLRG HTSYLSSQSFAWPLSCV in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA. Translation: AAR88428.1.
AB051499 mRNA. Translation: BAB21803.1. Different initiation.
AK094961 mRNA. Translation: BAG52965.1.
AK292484 mRNA. Translation: BAF85173.1.
AC097653 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04738.1.
CH471056 Genomic DNA. Translation: EAX04739.1.
CH471056 Genomic DNA. Translation: EAX04740.1.
BC038667 mRNA. Translation: AAH38667.1.
CCDSiCCDS34106.1. [Q9C0F1-1]
CCDS47163.1. [Q9C0F1-2]
RefSeqiNP_001035247.1. NM_001040157.2. [Q9C0F1-1]
NP_001138786.1. NM_001145314.1. [Q9C0F1-2]
XP_011530587.1. XM_011532285.2. [Q9C0F1-2]
XP_011530588.1. XM_011532286.2. [Q9C0F1-2]
XP_011530589.1. XM_011532287.2. [Q9C0F1-2]
XP_016864143.1. XM_017008654.1. [Q9C0F1-1]
XP_016864144.1. XM_017008655.1. [Q9C0F1-1]
UniGeneiHs.555989.

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118. [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118. [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118. [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118. [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118. [Q9C0F1-1]
GeneIDi80817.
KEGGihsa:80817.
UCSCiuc003itr.4. human. [Q9C0F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCEP44_HUMAN
AccessioniPrimary (citable) accession number: Q9C0F1
Secondary accession number(s): A8K8W9
, A8MW11, B3KT53, D3DP42, Q8IXZ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: March 28, 2018
This is version 108 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome