Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 44 kDa

Gene

CEP44

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 44 kDa
Short name:
Cep44
Alternative name(s):
HBV PreS1-transactivated protein 3
Short name:
PS1TP3
Gene namesi
Name:CEP44
Synonyms:KIAA1712
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:29356. CEP44.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • cytoplasm Source: UniProtKB-KW
  • midbody Source: UniProtKB
  • spindle pole Source: UniProtKB

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000164118.
PharmGKBiPA134933992.

Polymorphism and mutation databases

BioMutaiCEP44.
DMDMi152032537.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002937221 – 390Centrosomal protein of 44 kDaAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei331PhosphoserineCombined sources1
Modified residuei345PhosphoserineCombined sources1
Modified residuei346PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9C0F1.
MaxQBiQ9C0F1.
PaxDbiQ9C0F1.
PeptideAtlasiQ9C0F1.
PRIDEiQ9C0F1.

PTM databases

iPTMnetiQ9C0F1.
PhosphoSitePlusiQ9C0F1.

Expressioni

Gene expression databases

BgeeiENSG00000164118.
CleanExiHS_KIAA1712.
ExpressionAtlasiQ9C0F1. baseline and differential.
GenevisibleiQ9C0F1. HS.

Organism-specific databases

HPAiHPA041515.
HPA041835.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi123315. 145 interactors.
IntActiQ9C0F1. 135 interactors.
MINTiMINT-1459822.

Structurei

3D structure databases

ProteinModelPortaliQ9C0F1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili233 – 269Sequence analysisAdd BLAST37
Coiled coili361 – 385Sequence analysisAdd BLAST25

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEHB. Eukaryota.
ENOG4111F5M. LUCA.
GeneTreeiENSGT00390000009873.
HOGENOMiHOG000015329.
HOVERGENiHBG101789.
InParanoidiQ9C0F1.
KOiK16761.
OMAiQTMLAEC.
OrthoDBiEOG091G0EI4.
PhylomeDBiQ9C0F1.
TreeFamiTF332994.

Family and domain databases

InterProiView protein in InterPro
IPR033603. CEP44.
IPR029157. CEP44_CC.
PANTHERiPTHR31477. PTHR31477. 1 hit.
PfamiView protein in Pfam
PF15007. CEP44. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATGDLKRSL RNLEQVLRLL NYPEEVDCVG LIKGDPAASL PIISYSFTSY
60 70 80 90 100
SPYVTELIME SNVELIAKND LRFIDAVYKL LRDQFNYKPI LTKKQFIQCG
110 120 130 140 150
FAEWKIQIVC DILNCVMKKH KELSSLQKIP SQQRKKISSG KSEPPLGNEK
160 170 180 190 200
ISAEAVGVDI SGRFMTSGKK KAVVIRHLYN EDNVDISEDT LSPITDVNEA
210 220 230 240 250
VDVSDLNATE IKMPEVKVPE IKAEQQDVNV NPEITALQTM LAECQENLKK
260 270 280 290 300
LTSIEKRLDC LEQKMKGKVM VDENTWTNLL SRVTLLETEM LLSKKNDEFI
310 320 330 340 350
EFNEVSEDYA SCSDMDLLNP HRKSEVERPA SIPLSSGYST ASSDSTPRAS
360 370 380 390
TVNYCGLNEI SEETTIQKME RMKKMFEETA ELLKCPNHYL
Length:390
Mass (Da):44,140
Last modified:July 10, 2007 - v2
Checksum:i5B917C1159B1B7E2
GO
Isoform 2 (identifier: Q9C0F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-390: ETTIQKMERMKKMFEETAELLKCPNHYL → NFPAWSATSSCSSLSWLLRGHTSYLSSQSFAWPLSCV

Show »
Length:399
Mass (Da):44,762
Checksum:iE9B38E9A9C7ECED9
GO

Sequence cautioni

The sequence BAB21803 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033116147G → S2 PublicationsCorresponds to variant dbSNP:rs4695918Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041378363 – 390ETTIQ…PNHYL → NFPAWSATSSCSSLSWLLRG HTSYLSSQSFAWPLSCV in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA. Translation: AAR88428.1.
AB051499 mRNA. Translation: BAB21803.1. Different initiation.
AK094961 mRNA. Translation: BAG52965.1.
AK292484 mRNA. Translation: BAF85173.1.
AC097653 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX04738.1.
CH471056 Genomic DNA. Translation: EAX04739.1.
CH471056 Genomic DNA. Translation: EAX04740.1.
BC038667 mRNA. Translation: AAH38667.1.
CCDSiCCDS34106.1. [Q9C0F1-1]
CCDS47163.1. [Q9C0F1-2]
RefSeqiNP_001035247.1. NM_001040157.2. [Q9C0F1-1]
NP_001138786.1. NM_001145314.1. [Q9C0F1-2]
XP_011530587.1. XM_011532285.2. [Q9C0F1-2]
XP_011530588.1. XM_011532286.2. [Q9C0F1-2]
XP_011530589.1. XM_011532287.2. [Q9C0F1-2]
XP_016864143.1. XM_017008654.1. [Q9C0F1-1]
XP_016864144.1. XM_017008655.1. [Q9C0F1-1]
UniGeneiHs.555989.

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118. [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118. [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118. [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118. [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118. [Q9C0F1-1]
GeneIDi80817.
KEGGihsa:80817.
UCSCiuc003itr.4. human. [Q9C0F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCEP44_HUMAN
AccessioniPrimary (citable) accession number: Q9C0F1
Secondary accession number(s): A8K8W9
, A8MW11, B3KT53, D3DP42, Q8IXZ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: August 30, 2017
This is version 103 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations