Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor-interacting protein 2

Gene

GRIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.By similarity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000144596-MONOMER.
ReactomeiR-HSA-416993. Trafficking of GluR2-containing AMPA receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 2
Short name:
GRIP-2
Gene namesi
Name:GRIP2
Synonyms:KIAA1719
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:23841. GRIP2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi80852.

Polymorphism and mutation databases

BioMutaiGRIP2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000838521 – 1043Glutamate receptor-interacting protein 2Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei38PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9C0E4.
PeptideAtlasiQ9C0E4.
PRIDEiQ9C0E4.

PTM databases

iPTMnetiQ9C0E4.
PhosphoSitePlusiQ9C0E4.

Expressioni

Gene expression databases

CleanExiHS_GRIP2.

Organism-specific databases

HPAiHPA035673.

Interactioni

Subunit structurei

Interacts with EFNB1, EFNB3, GRIA2, GRIA3, CSPG4 and GRIPAP1. Can form homomultimers and heteromultimers with GRIP1 (By similarity). Interacts with the C-terminal tail of PRLHR.By similarity1 Publication

Protein-protein interaction databases

BioGridi123330. 6 interactors.
IntActiQ9C0E4. 6 interactors.
MINTiMINT-1785790.

Structurei

Secondary structure

11043
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi243 – 252Combined sources10
Beta strandi262 – 266Combined sources5
Beta strandi269 – 271Combined sources3
Beta strandi273 – 278Combined sources6
Helixi284 – 288Combined sources5
Beta strandi296 – 300Combined sources5
Helixi310 – 318Combined sources9
Beta strandi321 – 328Combined sources8
Beta strandi451 – 459Combined sources9
Turni463 – 465Combined sources3
Beta strandi469 – 472Combined sources4
Beta strandi477 – 480Combined sources4
Beta strandi486 – 490Combined sources5
Helixi495 – 498Combined sources4
Beta strandi509 – 511Combined sources3
Beta strandi514 – 516Combined sources3
Helixi521 – 532Combined sources12
Turni533 – 535Combined sources3
Beta strandi537 – 543Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V62NMR-A238-341[»]
1X5RNMR-A446-544[»]
ProteinModelPortaliQ9C0E4.
SMRiQ9C0E4.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9C0E4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 131PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini148 – 234PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini248 – 332PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini456 – 545PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini557 – 641PDZ 5PROSITE-ProRule annotationAdd BLAST85
Domaini656 – 738PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini941 – 1023PDZ 7PROSITE-ProRule annotationAdd BLAST83

Domaini

PDZ 5 mediates the C-terminal binding of GRIA2 and GRIA3. PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1. PDZ 7 mediates interaction with CSPG4 (By similarity).By similarity

Sequence similaritiesi

Belongs to the GRIP2 family.Curated
Contains 7 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

HOVERGENiHBG051841.
InParanoidiQ9C0E4.
KOiK20251.
PhylomeDBiQ9C0E4.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030029. GRIP2.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF42. PTHR10316:SF42. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0E4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLCGLSRETP GEADDGPYSK GGKDAGGADV SLACRRQSIP EEFRGITVVE
60 70 80 90 100
LIKKEGSTLG LTISGGTDKD GKPRVSNLRP GGLAARSDLL NIGDYIRSVN
110 120 130 140 150
GIHLTRLRHD EIITLLKNVG ERVVLEVEYE LPPPAPENNP RIISKTVDVS
160 170 180 190 200
LYKEGNSFGF VLRGGAHEDG HKSRPLVLTY VRPGGPADRE GSLKVGDRLL
210 220 230 240 250
SVDGIPLHGA SHATALATLR QCSHEALFQV EYDVATPDTV ANASGPLMVE
260 270 280 290 300
IVKTPGSALG ISLTTTSLRN KSVITIDRIK PASVVDRSGA LHPGDHILSI
310 320 330 340 350
DGTSMEHCSL LEATKLLASI SEKVRLEILP VPQSQRPLRP SEAVKVQRSE
360 370 380 390 400
QLHRWDPCVP SCHSPRPGHC RMPTWATPAG QDQSRSLSST PFSSPTLNHA
410 420 430 440 450
FSCNNPSTLP RGSQPMSPRT TMGRRRQRRR EHKSSLSLAS STVGPGGQIV
460 470 480 490 500
HTETTEVVLC GDPLSGFGLQ LQGGIFATET LSSPPLVCFI EPDSPAERCG
510 520 530 540 550
LLQVGDRVLS INGIATEDGT MEEANQLLRD AALAHKVVLE VEFDVAESVI
560 570 580 590 600
PSSGTFHVKL PKKRSVELGI TISSASRKRG EPLIISDIKK GSVAHRTGTL
610 620 630 640 650
EPGDKLLAID NIRLDNCPME DAVQILRQCE DLVKLKIRKD EDNSDELETT
660 670 680 690 700
GAVSYTVELK RYGGPLGITI SGTEEPFDPI VISGLTKRGL AERTGAIHVG
710 720 730 740 750
DRILAINNVS LKGRPLSEAI HLLQVAGETV TLKIKKQLDR PLLPRKSGSL
760 770 780 790 800
SETSDADEDP ADALKGGLPA ARFSPAVPSV DSAVESWDSS ATEGGFGGPG
810 820 830 840 850
SYTPQAAARG TTPQERRPGW LRGSPPPTEP RRTSYTPTPA DESFPEEEEG
860 870 880 890 900
DDWEPPTSPA PGPAREEGFW RMFGEALEDL ESCGQSELLR ELEASIMTGT
910 920 930 940 950
VQRVALEGRP GHRPWQRGRE VRASPAEMEE LLLPTPLEMH KVTLHKDPMR
960 970 980 990 1000
HDFGFSVSDG LLEKGVYVHT VRPDGPAHRG GLQPFDRVLQ VNHVRTRDFD
1010 1020 1030 1040
CCLAVPLLAE AGDVLELIIS RKPHTAHSSR APRSPGPSSP RML
Length:1,043
Mass (Da):112,501
Last modified:March 29, 2004 - v3
Checksum:i26E384310D706B1F
GO
Isoform 2 (identifier: Q9C0E4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     858-873: SPAPGPAREEGFWRMF → RHPVSPLSTPSHLPLF
     874-1043: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:873
Mass (Da):93,624
Checksum:i46682AF4EC2D544E
GO
Isoform 3 (identifier: Q9C0E4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MLCGLSRETPGE → QEWKRKWNSAFPSFSP
     135-170: APENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDG → GGCPWTGNFLHCLGCGWTRLPPHQGLGGRDHARWSG
     171-1043: Missing.

Note: Incomplete sequence. Due to intron retention. No experimental confirmation available.
Show »
Length:174
Mass (Da):18,938
Checksum:iA76F1C4FF8B51B74
GO

Sequence cautioni

The sequence BAB21810 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti850G → E (PubMed:11214971).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0097541 – 12MLCGL…ETPGE → QEWKRKWNSAFPSFSP in isoform 3. CuratedAdd BLAST12
Alternative sequenceiVSP_009755135 – 170APENN…AHEDG → GGCPWTGNFLHCLGCGWTRL PPHQGLGGRDHARWSG in isoform 3. CuratedAdd BLAST36
Alternative sequenceiVSP_009756171 – 1043Missing in isoform 3. CuratedAdd BLAST873
Alternative sequenceiVSP_009757858 – 873SPAPG…FWRMF → RHPVSPLSTPSHLPLF in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_009758874 – 1043Missing in isoform 2. 1 PublicationAdd BLAST170

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051506 mRNA. Translation: BAB21810.2. Different initiation.
AK074145 mRNA. Translation: BAB84971.1.
AK024507 mRNA. Translation: BAB15797.1.
RefSeqiNP_001073892.3. NM_001080423.3.
UniGeneiHs.517819.

Genome annotation databases

GeneIDi80852.
KEGGihsa:80852.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051506 mRNA. Translation: BAB21810.2. Different initiation.
AK074145 mRNA. Translation: BAB84971.1.
AK024507 mRNA. Translation: BAB15797.1.
RefSeqiNP_001073892.3. NM_001080423.3.
UniGeneiHs.517819.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V62NMR-A238-341[»]
1X5RNMR-A446-544[»]
ProteinModelPortaliQ9C0E4.
SMRiQ9C0E4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123330. 6 interactors.
IntActiQ9C0E4. 6 interactors.
MINTiMINT-1785790.

PTM databases

iPTMnetiQ9C0E4.
PhosphoSitePlusiQ9C0E4.

Polymorphism and mutation databases

BioMutaiGRIP2.

Proteomic databases

EPDiQ9C0E4.
PeptideAtlasiQ9C0E4.
PRIDEiQ9C0E4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi80852.
KEGGihsa:80852.

Organism-specific databases

CTDi80852.
DisGeNETi80852.
GeneCardsiGRIP2.
H-InvDBHIX0003085.
HGNCiHGNC:23841. GRIP2.
HPAiHPA035673.
neXtProtiNX_Q9C0E4.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

HOVERGENiHBG051841.
InParanoidiQ9C0E4.
KOiK20251.
PhylomeDBiQ9C0E4.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000144596-MONOMER.
ReactomeiR-HSA-416993. Trafficking of GluR2-containing AMPA receptors.

Miscellaneous databases

ChiTaRSiGRIP2. human.
EvolutionaryTraceiQ9C0E4.
GeneWikiiGRIP2.
GenomeRNAii80852.
PROiQ9C0E4.

Gene expression databases

CleanExiHS_GRIP2.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030029. GRIP2.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF42. PTHR10316:SF42. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGRIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9C0E4
Secondary accession number(s): Q8TEH9, Q9H7H3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 29, 2004
Last modified: November 2, 2016
This is version 122 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.