Q9C0E4 (GRIP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Glutamate receptor-interacting protein 2 Short name=GRIP-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1043 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons By similarity. |
| Subunit structure | Interacts with EFNB1, EFNB3, GRIA2, GRIA3, CSPG4 and GRIPAP1. Can form homomultimers and heteromultimers with GRIP1 By similarity. Interacts with the C-terminal tail of PRLHR. Ref.5 |
| Subcellular location | Cytoplasm By similarity. Membrane; Peripheral membrane protein By similarity. |
| Domain | PDZ 5 mediates the C-terminal binding of GRIA2 and GRIA3. PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1. PDZ 7 mediates interaction with CSPG4 By similarity. |
| Sequence similarities | Belongs to the GRIP2 family. Contains 7 PDZ (DHR) domains. |
| Sequence caution | The sequence BAB21810.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | synaptic transmission Traceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome plasma membraneTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9C0E4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9C0E4-2) The sequence of this isoform differs from the canonical sequence as follows: 858-873: SPAPGPAREEGFWRMF → RHPVSPLSTPSHLPLF 874-1043: Missing. | ||||||
| Note: Due to intron retention. No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9C0E4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-12: MLCGLSRETPGE → QEWKRKWNSAFPSFSP 135-170: APENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDG → GGCPWTGNFLHCLGCGWTRLPPHQGLGGRDHARWSG 171-1043: Missing. | ||||||
| Note: Incomplete sequence. Due to intron retention. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1043 | 1043 | Glutamate receptor-interacting protein 2 | PRO_0000083852 | ||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 48 – 131 | 84 | PDZ 1 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 148 – 234 | 87 | PDZ 2 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 248 – 332 | 85 | PDZ 3 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 456 – 545 | 90 | PDZ 4 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 557 – 641 | 85 | PDZ 5 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 656 – 738 | 83 | PDZ 6 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 941 – 1023 | 83 | PDZ 7 | |||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 12 | 12 | MLCGL…ETPGE → QEWKRKWNSAFPSFSP in isoform 3. | VSP_009754 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 135 – 170 | 36 | APENN…AHEDG → GGCPWTGNFLHCLGCGWTRL PPHQGLGGRDHARWSG in isoform 3. | VSP_009755 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 171 – 1043 | 873 | Missing in isoform 3. | VSP_009756 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 858 – 873 | 16 | SPAPG…FWRMF → RHPVSPLSTPSHLPLF in isoform 2. | VSP_009757 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 874 – 1043 | 170 | Missing in isoform 2. | VSP_009758 | ||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 850 | 1 | G → E Ref.4 | |||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 252 | 10 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 262 – 266 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 269 – 271 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 273 – 278 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 288 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 296 – 300 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 310 – 318 | 9 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 321 – 328 | 8 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 451 – 459 | 9 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 463 – 465 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 469 – 472 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 477 – 480 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 486 – 490 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 495 – 498 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 509 – 511 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 514 – 516 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 521 – 532 | 12 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 533 – 535 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 537 – 543 | 7 | ||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [3] | "The nucleotide sequence of a long cDNA clone isolated from human spleen." Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Spleen. |
| [4] | "Characterization of long cDNA clones from human adult spleen." Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O. DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 543-1043 (ISOFORM 2). Tissue: Spleen. |
| [5] | "The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering." Lin S.H.S., Arai A.C., Wang Z., Nothacker H.-P., Civelli O. Mol. Pharmacol. 60:916-923(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PRLHR. |
| [6] | "Solution structure of the 3rd and the 4th PDZ domain of GRIP2." RIKEN structural genomics initiative (RSGI) Submitted (MAY-2004) to the PDB data bank Cited for: STRUCTURE BY NMR OF 238-341 AND 446-544. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB051506 mRNA. Translation: BAB21810.2. Different initiation. AK074145 mRNA. Translation: BAB84971.1. AK024507 mRNA. Translation: BAB15797.1. | ||||||||||||||||||
| IPI | IPI00180230. IPI00383056. IPI00737140. | ||||||||||||||||||
| RefSeq | NP_001073892.2. NM_001080423.2. | ||||||||||||||||||
| UniGene | Hs.517819. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9C0E4. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9C0E4. 4 interactions. | ||||||||||||||||||
| MINT | MINT-1785790. | ||||||||||||||||||
| STRING | 9606.ENSP00000392703. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9C0E4. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 48474948. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9C0E4. | ||||||||||||||||||
| PRIDE | Q9C0E4. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| GeneID | 80852. | ||||||||||||||||||
| KEGG | hsa:80852. | ||||||||||||||||||
| UCSC | uc003byv.1. human. uc021wtn.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 80852. | ||||||||||||||||||
| GeneCards | GC03M014505. | ||||||||||||||||||
| H-InvDB | HIX0003085. | ||||||||||||||||||
| HGNC | HGNC:23841. GRIP2. | ||||||||||||||||||
| neXtProt | NX_Q9C0E4. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG297474. | ||||||||||||||||||
| HOVERGEN | HBG051841. | ||||||||||||||||||
| InParanoid | Q9C0E4. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_13685. Neuronal System. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| CleanEx | HS_GRIP2. | ||||||||||||||||||
| Genevestigator | Q9C0E4. | ||||||||||||||||||
| GermOnline | ENSG00000144596. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR001478. PDZ. [Graphical view] | ||||||||||||||||||
| Pfam | PF00595. PDZ. 7 hits. [Graphical view] | ||||||||||||||||||
| SMART | SM00228. PDZ. 7 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50156. PDZ. 7 hits. | ||||||||||||||||||
| PROSITE | PS50106. PDZ. 7 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q9C0E4. | ||||||||||||||||||
| GenomeRNAi | 80852. | ||||||||||||||||||
| NextBio | 71288. | ||||||||||||||||||
Entry information
| Entry name | GRIP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9C0E4 Secondary accession number(s): Q8TEH9, Q9H7H3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
