Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor-interacting protein 2

Gene

GRIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.By similarity

Enzyme and pathway databases

ReactomeiR-HSA-416993. Trafficking of GluR2-containing AMPA receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 2
Short name:
GRIP-2
Gene namesi
Name:GRIP2
Synonyms:KIAA1719
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:23841. GRIP2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiGRIP2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043Glutamate receptor-interacting protein 2PRO_0000083852Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei38 – 381PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9C0E4.
PeptideAtlasiQ9C0E4.
PRIDEiQ9C0E4.

PTM databases

iPTMnetiQ9C0E4.
PhosphoSiteiQ9C0E4.

Expressioni

Gene expression databases

CleanExiHS_GRIP2.

Interactioni

Subunit structurei

Interacts with EFNB1, EFNB3, GRIA2, GRIA3, CSPG4 and GRIPAP1. Can form homomultimers and heteromultimers with GRIP1 (By similarity). Interacts with the C-terminal tail of PRLHR.By similarity1 Publication

Protein-protein interaction databases

BioGridi123330. 6 interactions.
IntActiQ9C0E4. 6 interactions.
MINTiMINT-1785790.

Structurei

Secondary structure

1
1043
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi243 – 25210Combined sources
Beta strandi262 – 2665Combined sources
Beta strandi269 – 2713Combined sources
Beta strandi273 – 2786Combined sources
Helixi284 – 2885Combined sources
Beta strandi296 – 3005Combined sources
Helixi310 – 3189Combined sources
Beta strandi321 – 3288Combined sources
Beta strandi451 – 4599Combined sources
Turni463 – 4653Combined sources
Beta strandi469 – 4724Combined sources
Beta strandi477 – 4804Combined sources
Beta strandi486 – 4905Combined sources
Helixi495 – 4984Combined sources
Beta strandi509 – 5113Combined sources
Beta strandi514 – 5163Combined sources
Helixi521 – 53212Combined sources
Turni533 – 5353Combined sources
Beta strandi537 – 5437Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1V62NMR-A238-341[»]
1X5RNMR-A446-544[»]
ProteinModelPortaliQ9C0E4.
SMRiQ9C0E4. Positions 9-343, 448-739, 934-1023.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9C0E4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini48 – 13184PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini148 – 23487PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini248 – 33285PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini456 – 54590PDZ 4PROSITE-ProRule annotationAdd
BLAST
Domaini557 – 64185PDZ 5PROSITE-ProRule annotationAdd
BLAST
Domaini656 – 73883PDZ 6PROSITE-ProRule annotationAdd
BLAST
Domaini941 – 102383PDZ 7PROSITE-ProRule annotationAdd
BLAST

Domaini

PDZ 5 mediates the C-terminal binding of GRIA2 and GRIA3. PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1. PDZ 7 mediates interaction with CSPG4 (By similarity).By similarity

Sequence similaritiesi

Belongs to the GRIP2 family.Curated
Contains 7 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

HOVERGENiHBG051841.
InParanoidiQ9C0E4.
PhylomeDBiQ9C0E4.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030029. GRIP2.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF42. PTHR10316:SF42. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0E4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLCGLSRETP GEADDGPYSK GGKDAGGADV SLACRRQSIP EEFRGITVVE
60 70 80 90 100
LIKKEGSTLG LTISGGTDKD GKPRVSNLRP GGLAARSDLL NIGDYIRSVN
110 120 130 140 150
GIHLTRLRHD EIITLLKNVG ERVVLEVEYE LPPPAPENNP RIISKTVDVS
160 170 180 190 200
LYKEGNSFGF VLRGGAHEDG HKSRPLVLTY VRPGGPADRE GSLKVGDRLL
210 220 230 240 250
SVDGIPLHGA SHATALATLR QCSHEALFQV EYDVATPDTV ANASGPLMVE
260 270 280 290 300
IVKTPGSALG ISLTTTSLRN KSVITIDRIK PASVVDRSGA LHPGDHILSI
310 320 330 340 350
DGTSMEHCSL LEATKLLASI SEKVRLEILP VPQSQRPLRP SEAVKVQRSE
360 370 380 390 400
QLHRWDPCVP SCHSPRPGHC RMPTWATPAG QDQSRSLSST PFSSPTLNHA
410 420 430 440 450
FSCNNPSTLP RGSQPMSPRT TMGRRRQRRR EHKSSLSLAS STVGPGGQIV
460 470 480 490 500
HTETTEVVLC GDPLSGFGLQ LQGGIFATET LSSPPLVCFI EPDSPAERCG
510 520 530 540 550
LLQVGDRVLS INGIATEDGT MEEANQLLRD AALAHKVVLE VEFDVAESVI
560 570 580 590 600
PSSGTFHVKL PKKRSVELGI TISSASRKRG EPLIISDIKK GSVAHRTGTL
610 620 630 640 650
EPGDKLLAID NIRLDNCPME DAVQILRQCE DLVKLKIRKD EDNSDELETT
660 670 680 690 700
GAVSYTVELK RYGGPLGITI SGTEEPFDPI VISGLTKRGL AERTGAIHVG
710 720 730 740 750
DRILAINNVS LKGRPLSEAI HLLQVAGETV TLKIKKQLDR PLLPRKSGSL
760 770 780 790 800
SETSDADEDP ADALKGGLPA ARFSPAVPSV DSAVESWDSS ATEGGFGGPG
810 820 830 840 850
SYTPQAAARG TTPQERRPGW LRGSPPPTEP RRTSYTPTPA DESFPEEEEG
860 870 880 890 900
DDWEPPTSPA PGPAREEGFW RMFGEALEDL ESCGQSELLR ELEASIMTGT
910 920 930 940 950
VQRVALEGRP GHRPWQRGRE VRASPAEMEE LLLPTPLEMH KVTLHKDPMR
960 970 980 990 1000
HDFGFSVSDG LLEKGVYVHT VRPDGPAHRG GLQPFDRVLQ VNHVRTRDFD
1010 1020 1030 1040
CCLAVPLLAE AGDVLELIIS RKPHTAHSSR APRSPGPSSP RML
Length:1,043
Mass (Da):112,501
Last modified:March 29, 2004 - v3
Checksum:i26E384310D706B1F
GO
Isoform 2 (identifier: Q9C0E4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     858-873: SPAPGPAREEGFWRMF → RHPVSPLSTPSHLPLF
     874-1043: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:873
Mass (Da):93,624
Checksum:i46682AF4EC2D544E
GO
Isoform 3 (identifier: Q9C0E4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MLCGLSRETPGE → QEWKRKWNSAFPSFSP
     135-170: APENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDG → GGCPWTGNFLHCLGCGWTRLPPHQGLGGRDHARWSG
     171-1043: Missing.

Note: Incomplete sequence. Due to intron retention. No experimental confirmation available.
Show »
Length:174
Mass (Da):18,938
Checksum:iA76F1C4FF8B51B74
GO

Sequence cautioni

The sequence BAB21810.2 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti850 – 8501G → E (PubMed:11214971).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212MLCGL…ETPGE → QEWKRKWNSAFPSFSP in isoform 3. CuratedVSP_009754Add
BLAST
Alternative sequencei135 – 17036APENN…AHEDG → GGCPWTGNFLHCLGCGWTRL PPHQGLGGRDHARWSG in isoform 3. CuratedVSP_009755Add
BLAST
Alternative sequencei171 – 1043873Missing in isoform 3. CuratedVSP_009756Add
BLAST
Alternative sequencei858 – 87316SPAPG…FWRMF → RHPVSPLSTPSHLPLF in isoform 2. 1 PublicationVSP_009757Add
BLAST
Alternative sequencei874 – 1043170Missing in isoform 2. 1 PublicationVSP_009758Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051506 mRNA. Translation: BAB21810.2. Different initiation.
AK074145 mRNA. Translation: BAB84971.1.
AK024507 mRNA. Translation: BAB15797.1.
RefSeqiNP_001073892.3. NM_001080423.3.
UniGeneiHs.517819.

Genome annotation databases

GeneIDi80852.
KEGGihsa:80852.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051506 mRNA. Translation: BAB21810.2. Different initiation.
AK074145 mRNA. Translation: BAB84971.1.
AK024507 mRNA. Translation: BAB15797.1.
RefSeqiNP_001073892.3. NM_001080423.3.
UniGeneiHs.517819.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1V62NMR-A238-341[»]
1X5RNMR-A446-544[»]
ProteinModelPortaliQ9C0E4.
SMRiQ9C0E4. Positions 9-343, 448-739, 934-1023.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123330. 6 interactions.
IntActiQ9C0E4. 6 interactions.
MINTiMINT-1785790.

PTM databases

iPTMnetiQ9C0E4.
PhosphoSiteiQ9C0E4.

Polymorphism and mutation databases

BioMutaiGRIP2.

Proteomic databases

EPDiQ9C0E4.
PeptideAtlasiQ9C0E4.
PRIDEiQ9C0E4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi80852.
KEGGihsa:80852.

Organism-specific databases

CTDi80852.
GeneCardsiGRIP2.
H-InvDBHIX0003085.
HGNCiHGNC:23841. GRIP2.
neXtProtiNX_Q9C0E4.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

HOVERGENiHBG051841.
InParanoidiQ9C0E4.
PhylomeDBiQ9C0E4.

Enzyme and pathway databases

ReactomeiR-HSA-416993. Trafficking of GluR2-containing AMPA receptors.

Miscellaneous databases

ChiTaRSiGRIP2. human.
EvolutionaryTraceiQ9C0E4.
GeneWikiiGRIP2.
GenomeRNAii80852.
PROiQ9C0E4.

Gene expression databases

CleanExiHS_GRIP2.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030029. GRIP2.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF42. PTHR10316:SF42. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  3. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Nomura N., Kikuno R., Nagase T., Ohara O.
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Spleen.
  4. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 543-1043 (ISOFORM 2).
    Tissue: Spleen.
  5. "The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering."
    Lin S.H.S., Arai A.C., Wang Z., Nothacker H.-P., Civelli O.
    Mol. Pharmacol. 60:916-923(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PRLHR.
  6. "Solution structure of the 3rd and the 4th PDZ domain of GRIP2."
    RIKEN structural genomics initiative (RSGI)
    Submitted (MAY-2004) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 238-341 AND 446-544.

Entry informationi

Entry nameiGRIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9C0E4
Secondary accession number(s): Q8TEH9, Q9H7H3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 29, 2004
Last modified: July 6, 2016
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.