Reviewed,
UniProtKB/Swiss-Prot Q9C0B1 (FTO_HUMAN)
Last modified
June 16, 2009.
Version 35.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Protein fto Alternative name(s): Fat mass and obesity-associated protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 505 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The precise function of this protein remains to be determined. |
| Tissue specificity | Ubiquitously expressed, with relatively high expression in adrenal glands and brain; especially in hypothalamus and pituitary. Ref.4 Ref.5 |
| Polymorphism | At least one intronic variation within the gene predisposes to childhood and adult obesity. |
| Sequence similarities | Belongs to the fto family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Obesity |
| Gene Ontology (GO) | |
| Biological process | determination of left/right symmetry Inferred from sequence or structural similarity. Source: HGNC embryonic limb morphogenesisInferred from sequence or structural similarity. Source: HGNC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9C0B1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9C0B1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-378: Missing. 379-413: LRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGV → MEWRKVSECNSVEPCREVKKWPYRCIHHGKNFSRM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9C0B1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-445: Missing. 446-455: QNLRREWHAR → MACQGREECW | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9C0B1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-399: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 505 | 505 | Protein fto | PRO_0000286163 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 445 | 445 | Missing in isoform 3. | VSP_025002 | |||||
| Alternative sequence | 1 – 399 | 399 | Missing in isoform 4. | VSP_025003 | |||||
| Alternative sequence | 1 – 378 | 378 | Missing in isoform 2. | VSP_025004 | |||||
| Alternative sequence | 379 – 413 | 35 | LRQFW…KMEGV → MEWRKVSECNSVEPCREVKK WPYRCIHHGKNFSRM in isoform 2. | VSP_025005 | |||||
| Alternative sequence | 446 – 455 | 10 | QNLRREWHAR → MACQGREECW in isoform 3. | VSP_025006 | |||||
| Natural variant | 405 | 1 | A → V: dbSNP rs16952624. | VAR_032078 | |||||
Experimental info | |||||||||
| Sequence conflict | 316 | 1 | R → W in BAB21843. Ref.1 | ||||||
| Sequence conflict | 316 | 1 | R → W in AAH03583. Ref.3 | ||||||
| Sequence conflict | 316 | 1 | R → W in AAH30798. Ref.3 | ||||||
| Sequence conflict | 316 | 1 | R → W in AAI32893. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed: 11214970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Cervix, Eye and Lung. |
| [4] | "Variation in FTO contributes to childhood obesity and severe adult obesity." Dina C., Meyre D., Gallina S., Durand E., Korner A., Jacobson P., Carlsson L.M.S., Kiess W., Vatin V., Lecoeur C., Delplanque J., Vaillant E., Pattou F., Ruiz J., Weill J., Levy-Marchal C., Horber F., Potoczna N. Froguel P.Nat. Genet. 39:724-726(2007) [PubMed: 17496892] [Abstract] Cited for: INVOLVEMENT IN PREDISPOSITION OF OBESITY, TISSUE SPECIFICITY. |
| [5] | "A common variant in the FTO gene is associated with body mass index and predisposes to childhood and adult obesity." Frayling T.M., Timpson N.J., Weedon M.N., Zeggini E., Freathy R.M., Lindgren C.M., Perry J.R., Elliott K.S., Lango H., Rayner N.W., Shields B., Harries L.W., Barrett J.C., Ellard S., Groves C.J., Knight B., Patch A.M., Ness A.R. McCarthy M.I.Science 316:889-894(2007) [PubMed: 17434869] [Abstract] Cited for: INVOLVEMENT IN PREDISPOSITION OF OBESITY, TISSUE SPECIFICITY. |
| [6] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB051539 mRNA. Translation: BAB21843.1. Different initiation. AC007347 Genomic DNA. No translation available. AC007496 Genomic DNA. No translation available. AC007909 Genomic DNA. No translation available. BC003583 mRNA. Translation: AAH03583.1. BC030798 mRNA. Translation: AAH30798.1. BC132892 mRNA. Translation: AAI32893.1. BC137091 mRNA. Translation: AAI37092.1. | |
| IPI | IPI00028277. IPI00845224. IPI00845477. IPI00845501. |
| RefSeq | NP_001073901.1. |
| UniGene | Hs.528833 |
3D structure databases | |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q9C0B1. |
Genome annotation databases | |
| Ensembl | ENSG00000140718. Homo sapiens. [Contig view] |
| GeneID | 79068. |
| KEGG | hsa:79068. |
| NMPDR | fig|9606.3.peg.12249. |
Organism-specific databases | |
| GeneCards | GC16P052295. |
| HGNC | HGNC:24678. FTO. |
| HPA | CAB017123. |
| MIM | 610966. gene. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9C0B1. |
| OMA | Q9C0B1. TPVSRIL. |
Gene expression databases | |
| ArrayExpress | Q9C0B1. |
| Bgee | Q9C0B1. |
| CleanEx | HS_FTO. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 67845. |
| SOURCE | Search... |
Entry information
| Entry name | FTO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9C0B1 Secondary accession number(s): A2RUH1 Q7Z785 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


