Q9C0B1 (FTO_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha-ketoglutarate-dependent dioxygenase FTO EC=1.14.11.- Alternative name(s): Fat mass and obesity-associated protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 505 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Dioxygenase that repairs alkylated DNA and RNA by oxidative demethylation. Has highest activity towards single-stranded RNA containing 3-methyluracil, followed by single-stranded DNA containing 3-methylthymine. Has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine. Has no activity towards 1-methylguanine. Has no detectable activity towards double-stranded DNA. Requires molecular oxygen, alpha-ketoglutarate and iron. Contributes to the regulation of the global metabolic rate, energy expenditure and energy homeostasis. Contributes to the regulation of body size and body fat accumulation. Ref.6 Ref.9 |
| Cofactor | Binds 1 Fe2+ ion per subunit. Ref.9 |
| Enzyme regulation | Activated by ascorbate. Inhibited by N-oxalylglycine, fumarate and succinate By similarity. Ref.9 |
| Subunit structure | Monomer. May also exist as homodimer By similarity. |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Ubiquitously expressed, with relatively high expression in adrenal glands and brain; especially in hypothalamus and pituitary. Ref.4 Ref.5 |
| Domain | The 3D-structure of the Fe2OG dioxygenase domain is similar to that of the Fe2OG dioxygenase domain found in the bacterial DNA repair dioxygenase alkB and its mammalian orthologs, but sequence similarity is very low. As a consequence, the domain is not detected by protein signature databases. Ref.9 |
| Polymorphism | At least one intronic variation within the gene predisposes to childhood and adult obesity. |
| Involvement in disease | Growth retardation developmental delay coarse facies early death (GDFD) [MIM:612938]: A severe polymalformation syndrome characterized by postnatal growth retardation, microcephaly, severe psychomotor delay, functional brain deficits and characteristic facial dysmorphism. In some patients, structural brain malformations, cardiac defects, genital anomalies, and cleft palate are observed. Early death occurs by the age of 3 years. |
| Sequence similarities | Belongs to the fto family. |
| Biophysicochemical properties | pH dependence: Optimum pH is 5.5-6. Ref.6 |
| Sequence caution | The sequence BAB21843.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9C0B1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9C0B1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-378: Missing. 379-413: LRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGV → MEWRKVSECNSVEPCREVKKWPYRCIHHGKNFSRM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9C0B1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-445: Missing. 446-455: QNLRREWHAR → MACQGREECW | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9C0B1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-399: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 505 | 505 | Alpha-ketoglutarate-dependent dioxygenase FTO | PRO_0000286163 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 32 – 327 | 296 | Fe2OG dioxygenase domain | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 213 – 224 | 12 | Loop L1; predicted to block binding of double-stranded DNA or RNA | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 231 – 234 | 4 | Substrate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 316 – 318 | 3 | Alpha-ketoglutarate binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 231 | 1 | Iron; catalytic | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 233 | 1 | Iron; catalytic | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 307 | 1 | Iron; catalytic | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 96 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 108 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 205 | 1 | Alpha-ketoglutarate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 295 | 1 | Alpha-ketoglutarate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 320 | 1 | Alpha-ketoglutarate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 322 | 1 | Alpha-ketoglutarate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 216 | 1 | N6-acetyllysine Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 445 | 445 | Missing in isoform 3. | VSP_025002 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 399 | 399 | Missing in isoform 4. | VSP_025003 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 378 | 378 | Missing in isoform 2. | VSP_025004 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 379 – 413 | 35 | LRQFW…KMEGV → MEWRKVSECNSVEPCREVKK WPYRCIHHGKNFSRM in isoform 2. | VSP_025005 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 446 – 455 | 10 | QNLRREWHAR → MACQGREECW in isoform 3. | VSP_025006 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 316 | 1 | R → Q in GDFD; has no residual normal activity. Ref.10 | VAR_063252 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 405 | 1 | A → V. Corresponds to variant rs16952624 [ dbSNP | Ensembl ]. | VAR_032078 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 96 | 1 | R → M or W: Almost abolishes enzyme activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 108 | 1 | Y → A: Abolishes enzyme activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 114 | 1 | F → D: Perturbs interaction between N-terminal and C-terminal domains and strongly reduces enzyme activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 234 | 1 | E → P: Abolishes enzyme activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 392 | 1 | C → D: Perturbs interaction between N-terminal and C-terminal domains and strongly reduces enzyme activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | R → W in BAB21843. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | R → W in AAH03583. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | R → W in AAH30798. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | R → W in AAI32893. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 37 – 45 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 52 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 54 – 56 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 74 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 85 – 87 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 101 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 108 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 111 – 114 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 131 – 158 | 28 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 196 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 201 – 207 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 212 – 214 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 219 – 221 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 225 – 231 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 242 – 248 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 269 – 276 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 284 – 289 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 294 – 297 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 301 – 304 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 305 – 310 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 316 – 322 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 331 – 341 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 342 – 344 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 361 – 377 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 379 – 384 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 389 – 391 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 397 – 421 | 25 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 433 – 438 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 439 – 456 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 457 – 459 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 460 – 462 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 466 – 468 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 492 – 495 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Tissue: Brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4). Tissue: Cervix, Eye and Lung. |
| [4] | "Variation in FTO contributes to childhood obesity and severe adult obesity." Dina C., Meyre D., Gallina S., Durand E., Korner A., Jacobson P., Carlsson L.M.S., Kiess W., Vatin V., Lecoeur C., Delplanque J., Vaillant E., Pattou F., Ruiz J., Weill J., Levy-Marchal C., Horber F., Potoczna N. Froguel P.Nat. Genet. 39:724-726(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PREDISPOSITION OF OBESITY, TISSUE SPECIFICITY. |
| [5] | "A common variant in the FTO gene is associated with body mass index and predisposes to childhood and adult obesity." Frayling T.M., Timpson N.J., Weedon M.N., Zeggini E., Freathy R.M., Lindgren C.M., Perry J.R., Elliott K.S., Lango H., Rayner N.W., Shields B., Harries L.W., Barrett J.C., Ellard S., Groves C.J., Knight B., Patch A.M., Ness A.R. McCarthy M.I.Science 316:889-894(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN PREDISPOSITION OF OBESITY, TISSUE SPECIFICITY. |
| [6] | "Oxidative demethylation of 3-methylthymine and 3-methyluracil in single-stranded DNA and RNA by mouse and human FTO." Jia G., Yang C.G., Yang S., Jian X., Yi C., Zhou Z., He C. FEBS Lett. 582:3313-3319(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [7] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-216, MASS SPECTROMETRY. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "Crystal structure of the FTO protein reveals basis for its substrate specificity." Han Z., Niu T., Chang J., Lei X., Zhao M., Wang Q., Cheng W., Wang J., Feng Y., Chai J. Nature 464:1205-1209(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 32-505 IN COMPLEX WITH IRON IONS; N-OXALYLGLYCINE AND 3-METHYLTHYMIDINE, CATALYTIC ACTIVITY, FUNCTION, COFACTOR, ENZYME REGULATION, MUTAGENESIS OF ARG-96; TYR-108; PHE-114; GLU-234 AND CYS-392, CIRCULAR DICHROISM, DOMAIN. |
| [10] | "Loss-of-function mutation in the dioxygenase-encoding FTO gene causes severe growth retardation and multiple malformations." Boissel S., Reish O., Proulx K., Kawagoe-Takaki H., Sedgwick B., Yeo G.S., Meyre D., Golzio C., Molinari F., Kadhom N., Etchevers H.C., Saudek V., Farooqi I.S., Froguel P., Lindahl T., O'Rahilly S., Munnich A., Colleaux L. Am. J. Hum. Genet. 85:106-111(2009) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GDFD GLN-316, CHARACTERIZATION OF VARIANT GDFD GLN-316. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB051539 mRNA. Translation: BAB21843.1. Different initiation. AC007347 Genomic DNA. No translation available. AC007496 Genomic DNA. No translation available. AC007909 Genomic DNA. No translation available. BC003583 mRNA. Translation: AAH03583.1. BC030798 mRNA. Translation: AAH30798.1. BC132892 mRNA. Translation: AAI32893.1. BC137091 mRNA. Translation: AAI37092.1. | ||||||||||||
| IPI | IPI00028277. IPI00845224. IPI00845477. IPI00945698. | ||||||||||||
| RefSeq | NP_001073901.1. NM_001080432.2. | ||||||||||||
| UniGene | Hs.528833. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9C0B1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9C0B1. 2 interactions. | ||||||||||||
| STRING | 9606.ENSP00000418823. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9C0B1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 148841515. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9C0B1. | ||||||||||||
| PRIDE | Q9C0B1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 79068. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000431610; ENSP00000415636; ENSG00000140718. ENST00000460382; ENSP00000417422; ENSG00000140718. ENST00000463855; ENSP00000417843; ENSG00000140718. ENST00000471389; ENSP00000418823; ENSG00000140718. | ||||||||||||
| GeneID | 79068. | ||||||||||||
| KEGG | hsa:79068. | ||||||||||||
| UCSC | uc002ehr.3. human. uc010cbz.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 79068. | ||||||||||||
| GeneCards | GC16P053737. | ||||||||||||
| H-InvDB | HIX0013037. HIX0134382. HIX0204005. | ||||||||||||
| HGNC | HGNC:24678. FTO. | ||||||||||||
| HPA | CAB017123. | ||||||||||||
| MIM | 610966. gene. 612938. phenotype. | ||||||||||||
| neXtProt | NX_Q9C0B1. | ||||||||||||
| Orphanet | 210144. Lethal polymalformative syndrome, Boissel type. | ||||||||||||
| PharmGKB | PA152208656. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG45792. | ||||||||||||
| HOGENOM | HOG000273870. | ||||||||||||
| HOVERGEN | HBG101847. | ||||||||||||
| InParanoid | Q9C0B1. | ||||||||||||
| OMA | AVYNYSC. | ||||||||||||
| OrthoDB | EOG4SF969. | ||||||||||||
| PhylomeDB | Q9C0B1. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9C0B1. | ||||||||||||
| Bgee | Q9C0B1. | ||||||||||||
| CleanEx | HS_FTO. | ||||||||||||
| Genevestigator | Q9C0B1. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR024366. FTO_C. IPR024367. FTO_cat_dom. [Graphical view] | ||||||||||||
| Pfam | PF12934. FTO_CTD. 1 hit. PF12933. FTO_NTD. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | FTO. human. | ||||||||||||
| GenomeRNAi | 79068. | ||||||||||||
| NextBio | 67845. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FTO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9C0B1 Secondary accession number(s): A2RUH1 Q7Z785 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
