Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat and coiled-coil domain-containing protein 1

Gene

LRRCC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for the organization of the mitotic spindle. Maintains the structural integrity of centrosomes during mitosis.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat and coiled-coil domain-containing protein 1
Alternative name(s):
Centrosomal leucine-rich repeat and coiled-coil domain-containing protein
Gene namesi
Name:LRRCC1
Synonyms:CLERC, KIAA1764
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:29373. LRRCC1.

Subcellular locationi

GO - Cellular componenti

  • centriole Source: UniProtKB-SubCell
  • centrosome Source: UniProtKB
  • cytoplasm Source: HPA
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671519.

Polymorphism and mutation databases

BioMutaiLRRCC1.
DMDMi189028877.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10321032Leucine-rich repeat and coiled-coil domain-containing protein 1PRO_0000337081Add
BLAST

Proteomic databases

EPDiQ9C099.
MaxQBiQ9C099.
PaxDbiQ9C099.
PeptideAtlasiQ9C099.
PRIDEiQ9C099.

PTM databases

iPTMnetiQ9C099.
PhosphoSiteiQ9C099.

Expressioni

Gene expression databases

BgeeiENSG00000133739.
CleanExiHS_LRRCC1.
ExpressionAtlasiQ9C099. baseline and differential.
GenevisibleiQ9C099. HS.

Organism-specific databases

HPAiHPA012893.

Interactioni

Protein-protein interaction databases

BioGridi124531. 17 interactions.
IntActiQ9C099. 16 interactions.
MINTiMINT-1370797.
STRINGi9606.ENSP00000353538.

Structurei

3D structure databases

ProteinModelPortaliQ9C099.
SMRiQ9C099. Positions 33-180.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati44 – 6522LRR 1Add
BLAST
Repeati66 – 8722LRR 2Add
BLAST
Repeati88 – 10922LRR 3Add
BLAST
Repeati110 – 13122LRR 4Add
BLAST
Repeati136 – 15722LRR 5Add
BLAST
Domaini175 – 21844LRRCTAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili421 – 647227Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the LRRCC1 family.Curated
Contains 5 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG0531. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00780000122026.
HOGENOMiHOG000090214.
HOVERGENiHBG108104.
InParanoidiQ9C099.
KOiK16475.
OMAiEMQVKEV.
OrthoDBiEOG091G02Q1.
PhylomeDBiQ9C099.
TreeFamiTF329470.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS51450. LRR. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C099-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAAAAVVAA EAEVENEDGD SSCGDVCFMD KGLQSISELS LDSTLHAVNL
60 70 80 90 100
HCNNISKIEA IDHIWNLQHL DLSSNQISRI EGLNTLTKLC TLNLSCNLIT
110 120 130 140 150
KVEGLEELIN LTRLNVSYNH IDDLSGLIPL HGIKHKLRYI DLHSNRIDSI
160 170 180 190 200
HHLLQCMVGL HFLTNLILEK DGDDNPVCRL PGYRAVILQT LPQLRILDCK
210 220 230 240 250
NIFGEPVNLT EINSSQLQCL EGLLDNLVSS DSPLNISEDE IIDRMPVITA
260 270 280 290 300
PIDELVPLEQ FASTPSDAVL TSFMSVCQSS EPEKNNHEND LQNEIKLQKL
310 320 330 340 350
DDQILQLLNE TSNSIDNVLE KDPRPKRDTD ITSESDYGNR KECNRKVPRR
360 370 380 390 400
SKIPYDAKTI QTIKHHNKNY NSFVSCNRKM KPPYLKELYV SSSLANCPML
410 420 430 440 450
QESEKPKTEI IKVDQSHSED NTYQSLVEQL DQEREKRWRA EQAENKLMDY
460 470 480 490 500
IDELHKHANE KEDIHSLALL TTDRLKEIIF RERNSKGQLE VMVHKLQNEI
510 520 530 540 550
KKLTVELMKA KDQQEDHLKH LRTLEKTLEK MERQKRQQQA AQIRLIQEVE
560 570 580 590 600
LKASAADREI YLLRTSLHRE REQAQQLHQL LALKEQEHRK ELETREFFTD
610 620 630 640 650
ADFQDALAKE IAKEEKKHEQ MIKEYQEKID VLSQQYMDLE NEFRIALTVE
660 670 680 690 700
ARRFQDVKDG FENVATELAK SKHALIWAQR KENESSSLIK DLTCMVKEQK
710 720 730 740 750
TKLAEVSKLK QETAANLQNQ INTLEILIED DKQKSIQIEL LKHEKVQLIS
760 770 780 790 800
ELAAKESLIF GLRTERKVWG HELAQQGSSL AQNRGKLEAQ IESLSRENEC
810 820 830 840 850
LRKTNESDSD ALRIKCKIID DQTETIRKLK DCLQEKDEHI KRLQEKITEI
860 870 880 890 900
EKCTQEQLDE KSSQLDEVLE KLERHNERKE KLKQQLKGKE VELEEIRKAY
910 920 930 940 950
STLNRKWHDK GELLCHLETQ VKEVKEKFEN KEKKLKAERD KSIELQKNAM
960 970 980 990 1000
EKLHSMDDAF KRQVDAIVEA HQAEIAQLAN EKQKCIDSAN LKVHQIEKEM
1010 1020 1030
RELLEETCKN KKTMEAKIKQ LAFALNEIQQ DM
Length:1,032
Mass (Da):119,596
Last modified:May 20, 2008 - v2
Checksum:i4DC916268FBB12AB
GO
Isoform 2 (identifier: Q9C099-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MEAAAAVVAAEAEVENEDGDSSCGDVCFMDKGLQ → MLLKSIFIVYIFFY

Note: No experimental confirmation available.
Show »
Length:1,012
Mass (Da):117,930
Checksum:iF24A21EC879A47A4
GO

Sequence cautioni

The sequence AAH30701 differs from that shown. Reason: Erroneous termination at position 934. Translated as Lys.Curated
The sequence BAB21855 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB71115 differs from that shown.The sequence differs from that shown upstream of position 104 for unknown reason.Curated
The sequence BAB71115 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB71626 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAG63888 differs from that shown.Readthrough of an in-frame TAG stop codon in position 34 translated as Gln.Curated
The sequence BAG63888 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti90 – 901C → Y in BAB21855 (PubMed:11214970).Curated
Sequence conflicti90 – 901C → Y in BAG63888 (PubMed:14702039).Curated
Sequence conflicti121 – 1211I → V in AAH30701 (PubMed:15489334).Curated
Sequence conflicti343 – 3431C → Y in AAH30701 (PubMed:15489334).Curated
Sequence conflicti483 – 4831R → G in BAG63888 (PubMed:14702039).Curated
Sequence conflicti687 – 6871S → P in BAB71626 (PubMed:14702039).Curated
Sequence conflicti799 – 7991E → K in BAG63888 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691H → Q.
Corresponds to variant rs16913589 [ dbSNP | Ensembl ].
VAR_043584
Natural varianti210 – 2101T → A.
Corresponds to variant rs3736038 [ dbSNP | Ensembl ].
VAR_043585
Natural varianti613 – 6131K → N.
Corresponds to variant rs6985225 [ dbSNP | Ensembl ].
VAR_043586

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MEAAA…DKGLQ → MLLKSIFIVYIFFY in isoform 2. 1 PublicationVSP_033868Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051551 mRNA. Translation: BAB21855.1. Different initiation.
AK302648 mRNA. Translation: BAG63888.1. Sequence problems.
AK056185 mRNA. Translation: BAB71115.1. Sequence problems.
AK057990 mRNA. Translation: BAB71626.1. Different initiation.
AC011773 Genomic DNA. No translation available.
AC083962 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87121.1.
BC030701 mRNA. Translation: AAH30701.3. Sequence problems.
BR000818 mRNA. Translation: FAA00427.1.
CCDSiCCDS43750.1. [Q9C099-1]
RefSeqiNP_208325.3. NM_033402.4. [Q9C099-1]
UniGeneiHs.193115.

Genome annotation databases

EnsembliENST00000360375; ENSP00000353538; ENSG00000133739. [Q9C099-1]
ENST00000414626; ENSP00000394695; ENSG00000133739. [Q9C099-2]
GeneIDi85444.
KEGGihsa:85444.
UCSCiuc003ycw.4. human. [Q9C099-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051551 mRNA. Translation: BAB21855.1. Different initiation.
AK302648 mRNA. Translation: BAG63888.1. Sequence problems.
AK056185 mRNA. Translation: BAB71115.1. Sequence problems.
AK057990 mRNA. Translation: BAB71626.1. Different initiation.
AC011773 Genomic DNA. No translation available.
AC083962 Genomic DNA. No translation available.
CH471068 Genomic DNA. Translation: EAW87121.1.
BC030701 mRNA. Translation: AAH30701.3. Sequence problems.
BR000818 mRNA. Translation: FAA00427.1.
CCDSiCCDS43750.1. [Q9C099-1]
RefSeqiNP_208325.3. NM_033402.4. [Q9C099-1]
UniGeneiHs.193115.

3D structure databases

ProteinModelPortaliQ9C099.
SMRiQ9C099. Positions 33-180.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124531. 17 interactions.
IntActiQ9C099. 16 interactions.
MINTiMINT-1370797.
STRINGi9606.ENSP00000353538.

PTM databases

iPTMnetiQ9C099.
PhosphoSiteiQ9C099.

Polymorphism and mutation databases

BioMutaiLRRCC1.
DMDMi189028877.

Proteomic databases

EPDiQ9C099.
MaxQBiQ9C099.
PaxDbiQ9C099.
PeptideAtlasiQ9C099.
PRIDEiQ9C099.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360375; ENSP00000353538; ENSG00000133739. [Q9C099-1]
ENST00000414626; ENSP00000394695; ENSG00000133739. [Q9C099-2]
GeneIDi85444.
KEGGihsa:85444.
UCSCiuc003ycw.4. human. [Q9C099-1]

Organism-specific databases

CTDi85444.
GeneCardsiLRRCC1.
H-InvDBHIX0007624.
HGNCiHGNC:29373. LRRCC1.
HPAiHPA012893.
neXtProtiNX_Q9C099.
PharmGKBiPA142671519.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0531. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00780000122026.
HOGENOMiHOG000090214.
HOVERGENiHBG108104.
InParanoidiQ9C099.
KOiK16475.
OMAiEMQVKEV.
OrthoDBiEOG091G02Q1.
PhylomeDBiQ9C099.
TreeFamiTF329470.

Miscellaneous databases

ChiTaRSiLRRCC1. human.
GenomeRNAii85444.
PROiQ9C099.

Gene expression databases

BgeeiENSG00000133739.
CleanExiHS_LRRCC1.
ExpressionAtlasiQ9C099. baseline and differential.
GenevisibleiQ9C099. HS.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS51450. LRR. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLRCC1_HUMAN
AccessioniPrimary (citable) accession number: Q9C099
Secondary accession number(s): B4DYX6
, B5RI11, Q8N768, Q96DK7, Q96N01
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: September 7, 2016
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.