Q9BZS1 (FOXP3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Forkhead box protein P3 Alternative name(s): Scurfin | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 431 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable transcription factor. Plays a critical role in the control of immune response. |
| Subunit structure | Interacts with IKZF3. Ref.7 |
| Subcellular location | Nucleus Potential. |
| Involvement in disease | Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) [MIM:304790]; also known as X-linked autoimmunity-immunodeficiency syndrome. IPEX is characterized by neonatal onset insulin-dependent diabetes mellitus, infections, secretory diarrhea, trombocytopenia, anemia and eczema. It is usually lethal in infancy. Ref.8 Ref.9 Ref.10 Ref.11 |
| Sequence similarities | Contains 1 C2H2-type zinc finger. Contains 1 fork-head DNA-binding domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| IKZF3 | Q9UKT9 | 2 | EBI-983719,EBI-747204 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZS1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZS1-2) The sequence of this isoform differs from the canonical sequence as follows: 72-106: Missing. | ||||||
| Isoform 3 (identifier: Q9BZS1-3) The sequence of this isoform differs from the canonical sequence as follows: 72-106: Missing. 382-382: K → KVSSSEVAVTGMASSAIAAQSGQAWVWAHRHIGEERDVGCWWWLLASEVDAHLLPVPGLPQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 431 | 431 | Forkhead box protein P3 | PRO_0000091886 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Domain | 239 – 260 | 22 | Leucine-zipper | |||||||||||||||||||
| Zinc finger | 197 – 222 | 26 | C2H2-type | |||||||||||||||||||
| DNA binding | 337 – 423 | 87 | Fork-head | |||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 72 – 106 | 35 | Missing in isoform 2 and isoform 3. | VSP_015796 | ||||||||||||||||||
| Alternative sequence | 382 | 1 | K → KVSSSEVAVTGMASSAIAAQ SGQAWVWAHRHIGEERDVGC WWWLLASEVDAHLLPVPGLP Q in isoform 3. | VSP_036418 | ||||||||||||||||||
| Natural variant | 251 | 1 | Missing in IPEX. | VAR_011330 | ||||||||||||||||||
| Natural variant | 363 | 1 | I → V in IPEX. Ref.9 | VAR_023569 | ||||||||||||||||||
| Natural variant | 371 | 1 | F → C in IPEX. Ref.10 | VAR_011331 | ||||||||||||||||||
| Natural variant | 384 | 1 | A → T in IPEX. Ref.10 Ref.11 | VAR_011332 | ||||||||||||||||||
| Natural variant | 397 | 1 | R → W in IPEX. Ref.10 Corresponds to variant rs28935477 [ dbSNP | Ensembl ]. | VAR_011333 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Sequence conflict | 16 – 20 | 5 | LGPSP → MSPIS in CAA06748. Ref.6 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Helix | 342 – 351 | 10 | ||||||||||||||||||||
| Helix | 360 – 371 | 12 | ||||||||||||||||||||
| Turn | 372 – 375 | 4 | ||||||||||||||||||||
| Helix | 381 – 391 | 11 | ||||||||||||||||||||
| Beta strand | 395 – 398 | 4 | ||||||||||||||||||||
| Beta strand | 405 – 408 | 4 | ||||||||||||||||||||
| Helix | 410 – 416 | 7 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Disruption of a new forkhead/winged-helix protein, scurfin, results in the fatal lymphoproliferative disorder of the scurfy mouse." Brunkow M.E., Jeffery E.W., Hjerrild K.A., Paeper B., Clark L.B., Yasayko S.-A., Wilkinson J.E., Galas D., Ziegler S.F., Ramsdell F. Nat. Genet. 27:68-73(2001) [PubMed: 11138001] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Cloning and expression of the cDNA for FOXP3." Wang J., Liu Q., Zhang Y., Xu Z., Huang C. Submitted (APR-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Lin L., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Huang B., Zhou G., Yang S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
| [6] | "Transcription map in Xp11.23." Strom T.M., Nyakatura G., Hellebrand H., Drescher B., Rosenthal A., Meindl A. Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 16-431 (ISOFORM 3). |
| [7] | "Activation of the aryl hydrocarbon receptor induces human type 1 regulatory T cell-like and Foxp3(+) regulatory T cells." Gandhi R., Kumar D., Burns E.J., Nadeau M., Dake B., Laroni A., Kozoriz D., Weiner H.L., Quintana F.J. Nat. Immunol. 11:846-853(2010) [PubMed: 20676092] [Abstract] Cited for: INTERACTION WITH IKZF3. |
| [8] | "JM2, encoding a fork head-related protein, is mutated in X-linked autoimmunity-allergic disregulation syndrome." Chatila T.A., Blaeser F., Ho N., Lederman H.M., Voulgaropoulos C., Helms C., Bowcock A.M. J. Clin. Invest. 106:R75-R81(2000) [PubMed: 11120765] [Abstract] Cited for: VARIANT IPEX GLU-251 DEL. |
| [9] | "Novel mutations of FOXP3 in two Japanese patients with immune dysregulation, polyendocrinopathy, enteropathy, X linked syndrome (IPEX)." Kobayashi I., Shiari R., Yamada M., Kawamura N., Okano M., Yara A., Iguchi A., Ishikawa N., Ariga T., Sakiyama Y., Ochs H.D., Kobayashi K. J. Med. Genet. 38:874-876(2001) [PubMed: 11768393] [Abstract] Cited for: VARIANT IPEX VAL-363. |
| [10] | "X-linked neonatal diabetes mellitus, enteropathy and endocrinopathy syndrome is the human equivalent of mouse scurfy." Wildin R.S., Ramsdell F., Peake J., Faravelli F., Casanova J.-L., Buist N., Levy-Lahad E., Mazzella M., Goulet O., Perroni L., Bricarelli F.D., Byrne G., McEuen M., Proll S., Appleby M., Brunkow M.E. Nat. Genet. 27:18-20(2001) [PubMed: 11137992] [Abstract] Cited for: VARIANTS IPEX CYS-371; THR-384 AND TRP-397. |
| [11] | "The immune dysregulation, polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) is caused by mutations of FOXP3." Bennett C.L., Christie J., Ramsdell F., Brunkow M.E., Ferguson P.J., Whitesell L., Kelly T.E., Saulsbury F.T., Chance P.F., Ochs H.D. Nat. Genet. 27:20-21(2001) [PubMed: 11137993] [Abstract] Cited for: VARIANT IPEX THR-384. |
| + | Additional computationally mapped references. |
Web resources
| Atlas of Genetics and Cytogenetics in Oncology and Haematology |
| FOXP3base FOXP3 mutation db |
| GeneReviews |
| Wikipedia FOXP3 entry |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF277993 mRNA. Translation: AAG53607.1. EF534714 mRNA. Translation: ABQ15210.1. DQ010327 mRNA. Translation: AAY27088.1. AF235097 Genomic DNA. No translation available. BC113401 mRNA. Translation: AAI13402.1. BC113403 mRNA. Translation: AAI13404.1. BC143785 mRNA. Translation: AAI43786.1. AJ005891 mRNA. Translation: CAA06748.1. | ||||||||||||
| IPI | IPI00328094. IPI00604500. IPI00644203. | ||||||||||||
| RefSeq | NP_001107849.1. NM_001114377.1. NP_054728.2. NM_014009.3. | ||||||||||||
| UniGene | Hs.247700. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BZS1. | ||||||||||||
| SMR | Q9BZS1. Positions 336-417. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9BZS1. 3 interactions. | ||||||||||||
| STRING | Q9BZS1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 14548061. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9BZS1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000376199; ENSP00000365372; ENSG00000049768. ENST00000376207; ENSP00000365380; ENSG00000049768. | ||||||||||||
| GeneID | 50943. | ||||||||||||
| KEGG | hsa:50943. | ||||||||||||
| UCSC | uc004dne.2. human. uc004dnf.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 50943. | ||||||||||||
| GeneCards | GC0XM049106. | ||||||||||||
| H-InvDB | HIX0056162. | ||||||||||||
| HGNC | HGNC:6106. FOXP3. | ||||||||||||
| HPA | CAB026301. | ||||||||||||
| MIM | 300292. gene. 304790. phenotype. | ||||||||||||
| neXtProt | NX_Q9BZS1. | ||||||||||||
| Orphanet | 37042. X-linked immune dysregulation - polyendocrinopathy - enteropathy. | ||||||||||||
| PharmGKB | PA201094. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG16550. | ||||||||||||
| GeneTree | ENSGT00560000076806. | ||||||||||||
| HOVERGEN | HBG051656. | ||||||||||||
| OMA | PSRCSNP. | ||||||||||||
| OrthoDB | EOG4F7NK4. | ||||||||||||
| PhylomeDB | Q9BZS1. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | nfat_tfpathway. Calcineurin-regulated NFAT-dependent transcription in lymphocytes. il2_stat5pathway. IL2 signaling events mediated by STAT5. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BZS1. | ||||||||||||
| Bgee | Q9BZS1. | ||||||||||||
| CleanEx | HS_FOXP3. | ||||||||||||
| Genevestigator | Q9BZS1. | ||||||||||||
| GermOnline | ENSG00000049768. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR001766. TF_fork_head. IPR018122. TF_fork_head_CS. IPR011991. WHTH_trsnscrt_rep_DNA-bd. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 1 hit. G3DSA:3.30.160.60. Znf_C2H2/integrase_DNA-bd. 1 hit. | ||||||||||||
| KO | K10163. | ||||||||||||
| Pfam | PF00250. Fork_head. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00053. FORKHEAD. | ||||||||||||
| SMART | SM00339. FH. 1 hit. SM00355. ZnF_C2H2. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS00657. FORK_HEAD_1. False negative. PS00658. FORK_HEAD_2. 1 hit. PS50039. FORK_HEAD_3. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 1 hit. PS50157. ZINC_FINGER_C2H2_2. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 53405. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | FOXP3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZS1 Secondary accession number(s): A5HJT1 Q4ZH51 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with