Reviewed,
UniProtKB/Swiss-Prot Q9BZP3 (CR002_HUMAN)
Last modified
December 15, 2009.
Version 39.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Uncharacterized protein C18orf2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 86 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZP3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZP3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-22: Missing. | ||||||
| Isoform 3 (identifier: Q9BZP3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-23: MVRHPYSVQTQLSTEAKAIWRSM → MQCLYFILILKGYFHQQHHTLLITIALCFLQ 62-86: CNCPIIGEIVISCYWLFEIPPLISE → ETQKCIQKPLHEK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 86 | 86 | Uncharacterized protein C18orf2 | PRO_0000329448 | ||||
Natural variations | ||||||||
| Alternative sequence | 1 – 23 | 23 | MVRHP…IWRSM → MQCLYFILILKGYFHQQHHT LLITIALCFLQ in isoform 3. | VSP_032987 | ||||
| Alternative sequence | 1 – 22 | 22 | Missing in isoform 2. | VSP_032988 | ||||
| Alternative sequence | 62 – 86 | 25 | CNCPI…PLISE → ETQKCIQKPLHEK in isoform 3. | VSP_032989 | ||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "EST mining of the UniGene dataset to identify retina-specific genes." Stoehr H., Mah N., Schulz H.L., Gehrig A., Froehlich S., Weber B.H.F. Cytogenet. Cell Genet. 91:267-277(2000) [PubMed: 11173868] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY. Tissue: Retina. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
Cross-references
Sequence databases | |
|---|---|
| AF295726 mRNA. Translation: AAK13319.1. AF295728 mRNA. Translation: AAK13320.1. AF295729 mRNA. Translation: AAK13321.1. CH471113 Genomic DNA. Translation: EAX01703.1. CH471113 Genomic DNA. Translation: EAX01704.1. | |
| IPI | IPI00289169. IPI00889719. IPI00889778. |
| UniGene | Hs.541165 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9BZP3. |
Genome annotation databases | |
| Ensembl | ENST00000269201; ENSP00000269201; ENSG00000132204; Homo sapiens. [Genome view] |
Organism-specific databases | |
| GeneCards | GC18M001244. GC18U900451. |
| HGNC | HGNC:1225. C18orf2. |
| PharmGKB | PA25594. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9BZP3. |
| InParanoid | Q9BZP3. |
Gene expression databases | |
| ArrayExpress | Q9BZP3. |
| Bgee | Q9BZP3. |
| CleanEx | HS_C18orf2. |
| Genevestigator | Q9BZP3. |
Family and domain databases | |
| ProtoNet | Search... |
Entry information
| Entry name | CR002_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZP3 Secondary accession number(s): Q9BZP2, Q9BZP4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |

Clusters with


