Q9BZP3 (CR002_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 50.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative uncharacterized protein LINC00470 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 86 AA. |
| Sequence status | Complete. |
| Protein existence | Uncertain |
General annotation (Comments)
| Tissue specificity | Retina-specific. Ref.1 |
| Caution | Product of a dubious CDS prediction. May be a non-coding RNA. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZP3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZP3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-22: Missing. | ||||||
| Isoform 3 (identifier: Q9BZP3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-23: MVRHPYSVQTQLSTEAKAIWRSM → MQCLYFILILKGYFHQQHHTLLITIALCFLQ 62-86: CNCPIIGEIVISCYWLFEIPPLISE → ETQKCIQKPLHEK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||
Molecule processing | ||||||||
|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 86 | 86 | Putative uncharacterized protein LINC00470 | PRO_0000329448 | ||||
Natural variations | ||||||||
| Alternative sequence | 1 – 23 | 23 | MVRHP…IWRSM → MQCLYFILILKGYFHQQHHT LLITIALCFLQ in isoform 3. | VSP_032987 | ||||
| Alternative sequence | 1 – 22 | 22 | Missing in isoform 2. | VSP_032988 | ||||
| Alternative sequence | 62 – 86 | 25 | CNCPI…PLISE → ETQKCIQKPLHEK in isoform 3. | VSP_032989 | ||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "EST mining of the UniGene dataset to identify retina-specific genes." Stoehr H., Mah N., Schulz H.L., Gehrig A., Froehlich S., Weber B.H.F. Cytogenet. Cell Genet. 91:267-277(2000) [PubMed: 11173868] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY. Tissue: Retina. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF295726 mRNA. Translation: AAK13319.1. AF295728 mRNA. Translation: AAK13320.1. AF295729 mRNA. Translation: AAK13321.1. CH471113 Genomic DNA. Translation: EAX01703.1. CH471113 Genomic DNA. Translation: EAX01704.1. |
| IPI | IPI00289169. IPI00889719. IPI00889778. |
| UniGene | Hs.541165. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9BZP3. |
Proteomic databases | |
| PRIDE | Q9BZP3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000269201; ENSP00000269201; ENSG00000132204. |
Organism-specific databases | |
| GeneCards | GC18M001268. |
| HGNC | HGNC:1225. LINC00470. |
| HPA | HPA041046. |
| neXtProt | NX_Q9BZP3. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000004638. |
| InParanoid | Q9BZP3. |
| OrthoDB | EOG4HMJBZ. |
Gene expression databases | |
| ArrayExpress | Q9BZP3. |
| Bgee | Q9BZP3. |
| CleanEx | HS_C18orf2. |
| Genevestigator | Q9BZP3. |
Family and domain databases | |
| ProtoNet | Search... |
Entry information
| Entry name | CR002_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZP3 Secondary accession number(s): Q9BZP2, Q9BZP4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |

Clusters with