Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Group IIF secretory phospholipase A2

Gene

PLA2G2F

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in lipid mediator production in inflammatory conditions, by providing arachidonic acid to downstream cyclooxygenases and lipoxygenases (By similarity). Phospholipase A2, which catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides (PubMed:11112443). Hydrolyzes phosphatidylethanolamine more efficiently than phosphatidylcholine, with only a modest preference for arachidonic acid versus linoelic acid at the sn-2 position. Comparable activity toward 1-palmitoyl-2-oleoyl-phosphatidylserine vesicles to that toward 1-palmitoyl-2-oleoyl-phosphatidylglycerol (By similarity). Hydrolyzes phosphatidylglycerol versus phosphatidylcholine with a 15-fold preference (PubMed:11112443).By similarity1 Publication

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.PROSITE-ProRule annotation1 Publication

Cofactori

Ca2+1 PublicationNote: Binds 1 Ca2+ ion per subunit.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi47Calcium; via carbonyl oxygenBy similarity1
Metal bindingi49Calcium; via carbonyl oxygenBy similarity1
Metal bindingi51Calcium; via carbonyl oxygenBy similarity1
Active sitei67PROSITE-ProRule annotation1
Metal bindingi68CalciumBy similarity1
Active sitei114PROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
Biological processImmunity, Innate immunity, Lipid degradation, Lipid metabolism
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1482788 Acyl chain remodelling of PC
R-HSA-1482801 Acyl chain remodelling of PS
R-HSA-1482839 Acyl chain remodelling of PE
R-HSA-1482922 Acyl chain remodelling of PI
R-HSA-1482925 Acyl chain remodelling of PG
R-HSA-1483166 Synthesis of PA

Chemistry databases

SwissLipidsiSLP:000000654 [Q9BZM2-1]

Names & Taxonomyi

Protein namesi
Recommended name:
Group IIF secretory phospholipase A2 (EC:3.1.1.4)
Short name:
GIIF sPLA2
Short name:
sPLA2-IIF
Alternative name(s):
Phosphatidylcholine 2-acylhydrolase 2F
Gene namesi
Name:PLA2G2F
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000158786.4
HGNCiHGNC:30040 PLA2G2F
neXtProtiNX_Q9BZM2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi64600
OpenTargetsiENSG00000158786
PharmGKBiPA134931043

Chemistry databases

ChEMBLiCHEMBL4278
GuidetoPHARMACOLOGYi1420

Polymorphism and mutation databases

BioMutaiPLA2G2F
DMDMi20139134

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
ChainiPRO_000002275921 – 168Group IIF secretory phospholipase A2Add BLAST148

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi46 ↔ 138By similarity
Disulfide bondi48 ↔ 64By similarity
Disulfide bondi63 ↔ 120By similarity
Disulfide bondi69 ↔ 145By similarity
Disulfide bondi70 ↔ 113By similarity
Disulfide bondi79 ↔ 106By similarity
Glycosylationi92N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi98 ↔ 111By similarity
Glycosylationi102N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi123N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi144N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BZM2
PeptideAtlasiQ9BZM2
PRIDEiQ9BZM2

PTM databases

iPTMnetiQ9BZM2
PhosphoSitePlusiQ9BZM2

Expressioni

Tissue specificityi

Expressed at high levels in placenta, testis, thymus and at lower levels in heart, kidney, liver and prostate (PubMed:11112443). Highly expressed in rheumatoid arthritic tissues, including synovial lining cells in the intima, capillary endothelial cells and plasma cells (PubMed:11877435).2 Publications

Gene expression databases

BgeeiENSG00000158786
CleanExiHS_PLA2G2F
GenevisibleiQ9BZM2 HS

Interactioni

Protein-protein interaction databases

IntActiQ9BZM2, 3 interactors
STRINGi9606.ENSP00000364243

Chemistry databases

BindingDBiQ9BZM2

Structurei

3D structure databases

ProteinModelPortaliQ9BZM2
SMRiQ9BZM2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni139 – 168Required for localization on the plasma membraneBy similarityAdd BLAST30

Sequence similaritiesi

Belongs to the phospholipase A2 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG4087 Eukaryota
ENOG411283D LUCA
GeneTreeiENSGT00760000119160
HOGENOMiHOG000231749
HOVERGENiHBG008137
InParanoidiQ9BZM2
KOiK01047
OMAiYCQGPTP
OrthoDBiEOG091G0UZ3
PhylomeDBiQ9BZM2
TreeFamiTF319283

Family and domain databases

CDDicd00125 PLA2c, 1 hit
Gene3Di1.20.90.10, 1 hit
InterProiView protein in InterPro
IPR001211 PLipase_A2
IPR016090 PLipase_A2_dom
IPR036444 PLipase_A2_dom_sf
IPR033113 PLipase_A2_His_AS
PANTHERiPTHR11716 PTHR11716, 1 hit
PfamiView protein in Pfam
PF00068 Phospholip_A2_1, 1 hit
PRINTSiPR00389 PHPHLIPASEA2
SMARTiView protein in SMART
SM00085 PA2c, 1 hit
SUPFAMiSSF48619 SSF48619, 1 hit
PROSITEiView protein in PROSITE
PS00118 PA2_HIS, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BZM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKFFTVAIL AGSVLSTAHG SLLNLKAMVE AVTGRSAILS FVGYGCYCGL
60 70 80 90 100
GGRGQPKDEV DWCCHAHDCC YQELFDQGCH PYVDHYDHTI ENNTEIVCSD
110 120 130 140 150
LNKTECDKQT CMCDKNMVLC LMNQTYREEY RGFLNVYCQG PTPNCSIYEP
160
PPEEVTCSHQ SPAPPAPP
Length:168
Mass (Da):18,658
Last modified:June 1, 2001 - v1
Checksum:i35B159298246A762
GO
Isoform 2 (identifier: Q9BZM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGM

Note: No signal peptide could be predicted in this isoform, challenging its subcellular location within the secretory pathway and hence the formation of disulfide bonds, which are required for its activity. Gene prediction based on EST data. No experimental available.Curated
Show »
Length:211
Mass (Da):23,256
Checksum:i483B5E7850CB4248
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti149E → G in BAC04210 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0375241M → MADGAKANPKGFKKKVLDRC FSGWRGPRFGASCPSRTSRS SLGM in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF306566 mRNA Translation: AAG50242.1
AK093645 mRNA Translation: BAC04210.1
AL158172 Genomic DNA No translation available.
Z98257 Genomic DNA No translation available.
CCDSiCCDS204.2 [Q9BZM2-2]
RefSeqiNP_073730.3, NM_022819.3 [Q9BZM2-2]
XP_011540258.1, XM_011541956.1 [Q9BZM2-2]
UniGeneiHs.302034

Genome annotation databases

EnsembliENST00000375102; ENSP00000364243; ENSG00000158786 [Q9BZM2-2]
GeneIDi64600
KEGGihsa:64600
UCSCiuc009vpp.2 human [Q9BZM2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPA2GF_HUMAN
AccessioniPrimary (citable) accession number: Q9BZM2
Secondary accession number(s): Q5R385, Q8N217, Q9H506
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 2001
Last modified: April 25, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health