Q9BZM2 (PA2GF_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Group IIF secretory phospholipase A2 Short name=GIIF sPLA2 Short name=sPLA2-IIF EC=3.1.1.4 Alternative name(s): Phosphatidylcholine 2-acylhydrolase 2F | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 168 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Hydrolyzes phosphatidylglycerol versus phosphatidylcholine with a 15-fold preference. Ref.1 |
| Catalytic activity | Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate. Ref.1 |
| Cofactor | Binds 1 calcium ion per subunit. Ref.1 |
| Subcellular location | |
| Tissue specificity | Expressed at high levels in placenta, testis, thymus and at lower levels in heart, kidney, liver and prostate. Ref.1 |
| Sequence similarities | Belongs to the phospholipase A2 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZM2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZM2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||||
| Chain | 21 – 168 | 148 | Group IIF secretory phospholipase A2 | PRO_0000022759 | |||||||
Sites | |||||||||||
| Active site | 67 | 1 | By similarity | ||||||||
| Active site | 114 | 1 | By similarity | ||||||||
| Metal binding | 47 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 49 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 51 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 68 | 1 | Calcium By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 123 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 144 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 46 ↔ 138 | By similarity | |||||||||
| Disulfide bond | 48 ↔ 64 | By similarity | |||||||||
| Disulfide bond | 63 ↔ 120 | By similarity | |||||||||
| Disulfide bond | 69 ↔ 145 | By similarity | |||||||||
| Disulfide bond | 70 ↔ 113 | By similarity | |||||||||
| Disulfide bond | 79 ↔ 106 | By similarity | |||||||||
| Disulfide bond | 98 ↔ 111 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MADGAKANPKGFKKKVLDRC FSGWRGPRFGASCPSRTSRS SLGM in isoform 2. | VSP_037524 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 149 | 1 | E → G in BAC04210. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF306566 mRNA. Translation: AAG50242.1. AK093645 mRNA. Translation: BAC04210.1. AL158172, Z98257 Genomic DNA. Translation: CAI19658.1. Z98257, AL158172 Genomic DNA. Translation: CAI20260.1. |
| IPI | IPI00010184. IPI00930096. |
| RefSeq | NP_073730.3. NM_022819.3. |
| UniGene | Hs.302034. |
3D structure databases | |
| ProteinModelPortal | Q9BZM2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000364243. |
Polymorphism databases | |
| DMDM | 20139134. |
Proteomic databases | |
| PaxDb | Q9BZM2. |
| PRIDE | Q9BZM2. |
Protocols and materials databases | |
| DNASU | 64600. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000375102; ENSP00000364243; ENSG00000158786. |
| GeneID | 64600. |
| KEGG | hsa:64600. |
| UCSC | uc009vpp.1. human. |
Organism-specific databases | |
| CTD | 64600. |
| GeneCards | GC01P020465. |
| H-InvDB | HIX0000212. |
| HGNC | HGNC:30040. PLA2G2F. |
| neXtProt | NX_Q9BZM2. |
| PharmGKB | PA134931043. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG296589. |
| HOGENOM | HOG000231749. |
| HOVERGEN | HBG008137. |
| InParanoid | Q9BZM2. |
| KO | K01047. |
| OMA | LNLKSMV. |
| OrthoDB | EOG4933JS. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| Bgee | Q9BZM2. |
| CleanEx | HS_PLA2G2F. |
| Genevestigator | Q9BZM2. |
| GermOnline | ENSG00000158786. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.90.10. 1 hit. |
| InterPro | IPR001211. PLipase_A2. IPR013090. PLipase_A2_AS. IPR016090. PLipase_A2_dom. [Graphical view] |
| PANTHER | PTHR11716. PTHR11716. 1 hit. |
| Pfam | PF00068. Phospholip_A2_1. 1 hit. [Graphical view] |
| PRINTS | PR00389. PHPHLIPASEA2. |
| SMART | SM00085. PA2c. 1 hit. [Graphical view] |
| SUPFAM | SSF48619. PhospholipaseA2. 1 hit. |
| PROSITE | PS00119. PA2_ASP. False negative. PS00118. PA2_HIS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9BZM2. |
| ChEMBL | CHEMBL4278. |
| GenomeRNAi | 64600. |
| NextBio | 66565. |
Entry information
| Entry name | PA2GF_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZM2 Secondary accession number(s): Q5R385, Q8N217, Q9H506 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
