Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1 regulatory subunit 12C

Gene

PPP1R12C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates myosin phosphatase activity.1 Publication

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125503-MONOMER.
SIGNORiQ9BZL4.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 12C
Alternative name(s):
Protein phosphatase 1 myosin-binding subunit of 85 kDa
Short name:
Protein phosphatase 1 myosin-binding subunit p85
Gene namesi
Name:PPP1R12CImported
Synonyms:LENG3, MBS851 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:14947. PPP1R12C.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi54776.
OpenTargetsiENSG00000125503.
PharmGKBiPA33619.

Polymorphism and mutation databases

DMDMi74752476.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00003158632 – 782Protein phosphatase 1 regulatory subunit 12CAdd BLAST781

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei399PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei452PhosphoserineCombined sources1
Modified residuei509PhosphoserineCombined sources1
Modified residuei560Phosphothreonine; by CDC42BP and ROCK2Combined sources1 Publication1
Modified residuei604PhosphoserineCombined sources1
Modified residuei647PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylation at Thr-560 is essential for its interaction with PPP1CB.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9BZL4.
MaxQBiQ9BZL4.
PaxDbiQ9BZL4.
PeptideAtlasiQ9BZL4.
PRIDEiQ9BZL4.

PTM databases

iPTMnetiQ9BZL4.
PhosphoSitePlusiQ9BZL4.

Expressioni

Tissue specificityi

Ubiquitously expressed. Highly expressed in heart.1 Publication

Gene expression databases

BgeeiENSG00000125503.
CleanExiHS_PPP1R12C.
ExpressionAtlasiQ9BZL4. baseline and differential.
GenevisibleiQ9BZL4. HS.

Organism-specific databases

HPAiHPA043532.

Interactioni

Subunit structurei

PP1 comprises a catalytic subunit, PPP1CA, PPP1CB or PPP1CC, and one or several targeting or regulatory subunits. PPP1R12C mediates binding to myosin. Interacts via its N-terminus with PPP1CB. Interacts with IL16. Interacts with the coiled-coil domain of MPRIP.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
C1orf109Q9NX043EBI-10289057,EBI-8643161
RBM17Q96I253EBI-10289057,EBI-740272
SMAD3P840222EBI-721802,EBI-347161

Protein-protein interaction databases

BioGridi120144. 16 interactors.
IntActiQ9BZL4. 18 interactors.
MINTiMINT-1488862.
STRINGi9606.ENSP00000263433.

Structurei

3D structure databases

ProteinModelPortaliQ9BZL4.
SMRiQ9BZL4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati100 – 129ANK 1Sequence analysisAdd BLAST30
Repeati133 – 162ANK 2Sequence analysisAdd BLAST30
Repeati226 – 255ANK 3Sequence analysisAdd BLAST30
Repeati259 – 288ANK 4Sequence analysisAdd BLAST30

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili297 – 329Sequence analysisAdd BLAST33
Coiled coili681 – 782Sequence analysisAdd BLAST102

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi473 – 523Pro-richSequence analysisAdd BLAST51

Sequence similaritiesi

Contains 4 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0505. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00760000119141.
HOGENOMiHOG000290648.
HOVERGENiHBG104929.
InParanoidiQ9BZL4.
KOiK17457.
OMAiPERRMAE.
OrthoDBiEOG091G06U5.
PhylomeDBiQ9BZL4.
TreeFamiTF105543.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR031205. PPP1R12C.
IPR031775. PRKG1_interact.
[Graphical view]
PANTHERiPTHR24179:SF27. PTHR24179:SF27. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF15898. PRKG1_interact. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 13 Publications (identifier: Q9BZL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGEDGPAAG PGAAAAAARE RRREQLRQWG ARAGAEPGPG ERRARTVRFE
60 70 80 90 100
RAAEFLAACA GGDLDEARLM LRAADPGPGA ELDPAAPPPA RAVLDSTNAD
110 120 130 140 150
GISALHQACI DENLEVVRFL VEQGATVNQA DNEGWTPLHV AASCGYLDIA
160 170 180 190 200
RYLLSHGANI AAVNSDGDLP LDLAESDAME GLLKAEIARR GVDVEAAKRA
210 220 230 240 250
EEELLLHDTR CWLNGGAMPE ARHPRTGASA LHVAAAKGYI EVMRLLLQAG
260 270 280 290 300
YDPELRDGDG WTPLHAAAHW GVEDACRLLA EHGGGMDSLT HAGQRPCDLA
310 320 330 340 350
DEEVLSLLEE LARKQEDLRN QKEASQSRGQ EPQAPSSSKH RRSSVCRLSS
360 370 380 390 400
REKISLQDLS KERRPGGAGG PPIQDEDEGE EGPTEPPPAE PRTLNGVSSP
410 420 430 440 450
PHPSPKSPVQ LEEAPFSRRF GLLKTGSSGA LGPPERRTAE GAPGAGLQRS
460 470 480 490 500
ASSSWLEGTS TQAKELRLAR ITPTPSPKLP EPSVLSEVTK PPPCLENSSP
510 520 530 540 550
PSRIPEPESP AKPNVPTAST APPADSRDRR RSYQMPVRDE ESESQRKARS
560 570 580 590 600
RLMRQSRRST QGVTLTDLKE AEKAAGKAPE SEKPAQSLDP SRRPRVPGVE
610 620 630 640 650
NSDSPAQRAE APDGQGPGPQ AAREHRKVGK EWRGPAEGEE AEPADRSQES
660 670 680 690 700
STLEGGPSAR RQRWQRDLNP EPEPESEEPD GGFRTLYAEL RRENERLREA
710 720 730 740 750
LTETTLRLAQ LKVELERATQ RQERFAERPA LLELERFERR ALERKAAELE
760 770 780
EELKALSDLR ADNQRLKDEN AALIRVISKL SK
Length:782
Mass (Da):84,881
Last modified:June 1, 2001 - v1
Checksum:i677E7EB1B62C2CC8
GO
Isoform 21 Publication (identifier: Q9BZL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     576-638: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:719
Mass (Da):78,234
Checksum:i6E800246823EC0C4
GO
Isoform 3 (identifier: Q9BZL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-410: Missing.
     609-609: Missing.

Note: No experimental confirmation available.
Show »
Length:780
Mass (Da):84,682
Checksum:iCD10D87B6E68FE49
GO
Isoform 4 (identifier: Q9BZL4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     609-609: Missing.

Note: No experimental confirmation available.
Show »
Length:781
Mass (Da):84,810
Checksum:iEE25D3C5CF1E4D6F
GO
Isoform 5 (identifier: Q9BZL4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MSGEDGPAAGPGAAAAAARERRREQLRQWGAR → MRNGGPCQPLAAGPRAEGASVNWSVTAWGPGT
     33-106: Missing.
     609-609: Missing.

Note: No experimental confirmation available.
Show »
Length:707
Mass (Da):77,169
Checksum:i991C11608AB2807F
GO

Sequence cautioni

The sequence AF211968 differs from that shown. Unspliced mRNA.Curated
The sequence BAB15651 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC85179 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti438T → I in AAH08030 (PubMed:15489334).Curated1
Sequence conflicti527R → W in BAB15651 (PubMed:14702039).Curated1
Sequence conflicti537V → A in BAC85179 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048310419R → C.Corresponds to variant rs35849605dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0572161 – 32MSGED…QWGAR → MRNGGPCQPLAAGPRAEGAS VNWSVTAWGPGT in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05721733 – 106Missing in isoform 5. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_030750410Missing in isoform 3. 2 Publications1
Alternative sequenceiVSP_052643576 – 638Missing in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_030751609Missing in isoform 3, isoform 4 and isoform 5. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF312028 mRNA. Translation: AAG60045.1.
AB209452 mRNA. Translation: BAD92689.1.
AK129529 mRNA. Translation: BAC85179.1. Different initiation.
AK297426 mRNA. Translation: BAG59854.1.
AK027086 mRNA. Translation: BAB15651.1. Different initiation.
AC005782 Genomic DNA. No translation available.
AC010327 Genomic DNA. No translation available.
AF211968 mRNA. No translation available.
AL137618 mRNA. Translation: CAB70844.1.
BC008030 mRNA. Translation: AAH08030.1.
CCDSiCCDS12916.1. [Q9BZL4-1]
PIRiT46318.
RefSeqiNP_001258547.1. NM_001271618.1. [Q9BZL4-3]
NP_060077.1. NM_017607.3. [Q9BZL4-1]
XP_005259070.1. XM_005259013.3. [Q9BZL4-4]
UniGeneiHs.631579.

Genome annotation databases

EnsembliENST00000263433; ENSP00000263433; ENSG00000125503. [Q9BZL4-1]
ENST00000435544; ENSP00000387833; ENSG00000125503. [Q9BZL4-5]
GeneIDi54776.
KEGGihsa:54776.
UCSCiuc002qix.5. human. [Q9BZL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF312028 mRNA. Translation: AAG60045.1.
AB209452 mRNA. Translation: BAD92689.1.
AK129529 mRNA. Translation: BAC85179.1. Different initiation.
AK297426 mRNA. Translation: BAG59854.1.
AK027086 mRNA. Translation: BAB15651.1. Different initiation.
AC005782 Genomic DNA. No translation available.
AC010327 Genomic DNA. No translation available.
AF211968 mRNA. No translation available.
AL137618 mRNA. Translation: CAB70844.1.
BC008030 mRNA. Translation: AAH08030.1.
CCDSiCCDS12916.1. [Q9BZL4-1]
PIRiT46318.
RefSeqiNP_001258547.1. NM_001271618.1. [Q9BZL4-3]
NP_060077.1. NM_017607.3. [Q9BZL4-1]
XP_005259070.1. XM_005259013.3. [Q9BZL4-4]
UniGeneiHs.631579.

3D structure databases

ProteinModelPortaliQ9BZL4.
SMRiQ9BZL4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120144. 16 interactors.
IntActiQ9BZL4. 18 interactors.
MINTiMINT-1488862.
STRINGi9606.ENSP00000263433.

PTM databases

iPTMnetiQ9BZL4.
PhosphoSitePlusiQ9BZL4.

Polymorphism and mutation databases

DMDMi74752476.

Proteomic databases

EPDiQ9BZL4.
MaxQBiQ9BZL4.
PaxDbiQ9BZL4.
PeptideAtlasiQ9BZL4.
PRIDEiQ9BZL4.

Protocols and materials databases

DNASUi54776.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263433; ENSP00000263433; ENSG00000125503. [Q9BZL4-1]
ENST00000435544; ENSP00000387833; ENSG00000125503. [Q9BZL4-5]
GeneIDi54776.
KEGGihsa:54776.
UCSCiuc002qix.5. human. [Q9BZL4-1]

Organism-specific databases

CTDi54776.
DisGeNETi54776.
GeneCardsiPPP1R12C.
HGNCiHGNC:14947. PPP1R12C.
HPAiHPA043532.
MIMi613245. gene.
neXtProtiNX_Q9BZL4.
OpenTargetsiENSG00000125503.
PharmGKBiPA33619.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0505. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00760000119141.
HOGENOMiHOG000290648.
HOVERGENiHBG104929.
InParanoidiQ9BZL4.
KOiK17457.
OMAiPERRMAE.
OrthoDBiEOG091G06U5.
PhylomeDBiQ9BZL4.
TreeFamiTF105543.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125503-MONOMER.
SIGNORiQ9BZL4.

Miscellaneous databases

GenomeRNAii54776.
PROiQ9BZL4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125503.
CleanExiHS_PPP1R12C.
ExpressionAtlasiQ9BZL4. baseline and differential.
GenevisibleiQ9BZL4. HS.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR031205. PPP1R12C.
IPR031775. PRKG1_interact.
[Graphical view]
PANTHERiPTHR24179:SF27. PTHR24179:SF27. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF15898. PRKG1_interact. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPP12C_HUMAN
AccessioniPrimary (citable) accession number: Q9BZL4
Secondary accession number(s): B4DME2
, Q59FK8, Q6ZPD1, Q7L8F7, Q96HW1, Q9H5H5, Q9NT00
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Although assigned as two separate genes (PPP1R12C and LENG3), it is probable that LENG3 does not exist by itself and is a part of the PPP1R12C gene.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.