Q9BZG9 (LYNX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ly-6/neurotoxin-like protein 1 Alternative name(s): Secreted Ly-6/uPAR domain-containing protein 2 Secreted Ly-6/uPAR-related protein 2 Short name=SLURP-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 131 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). In brain, isoform 2 modulates functional properties of nAChRs to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs By similarity. Prevents plasticity in the primary visual cortex late in life By similarity. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis. Ref.2 |
| Subunit structure | Isoform 2 interacts with nAChRs, including alpha4beta2 (CHRNA4/CHRNB2) and alpha7 (CHRNA7) By similarity. Competes with alpha-bungarotoxin for nAChR alpha7 binding. Isoform 3 may interact with heteropentameric nAChRs expressed by keratinocytes. Ref.2 |
| Subcellular location | Isoform 1: Secreted Potential Ref.2. Isoform 2: Cell membrane; Lipid-anchor › GPI-anchor Potential. Cell projection › dendrite By similarity. Note: Detected in Purkinje cells soma and proximal dendrites By similarity. Ref.2 |
| Tissue specificity | Isoform 3 is expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level). Up-regulated 3-fold in psoriatic lesional skin. Detected in serum (at protein level). Ref.1 Ref.2 |
| Miscellaneous | Isoform 2 is considered to be an endogenous "prototoxin", that shares a N-terminal three-finger structure with snake alpha-neurotoxins. |
| Sequence similarities | Contains 1 UPAR/Ly6 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cell projection Membrane Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| PTM | Disulfide bond GPI-anchor Glycoprotein Lipoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | anchored to membrane Inferred from electronic annotation. Source: UniProtKB-KW dendriteInferred from electronic annotation. Source: UniProtKB-SubCell extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZG9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZG9-2) Also known as: LYNX1; The sequence of this isoform differs from the canonical sequence as follows: 52-131: SAAEAIWCHQ...CCQTSLCNHD → YYTPTRMKVS...ILLATLWGLL | ||||||
| Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential). | ||||||
| Isoform 3 (identifier: Q9BZG9-3) Also known as: SLURP-2; The sequence of this isoform differs from the canonical sequence as follows: 2-52: TPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTS → QLGTGLLLAAVLSLQLA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||||||||||
| Chain | 21 – 131 | 111 | Ly-6/neurotoxin-like protein 1 | PRO_0000036154 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 59 – 129 | 71 | UPAR/Ly6 | ||||||||||||||
Amino acid modifications | |||||||||||||||||
| Disulfide bond | 59 ↔ 81 | Potential | |||||||||||||||
| Disulfide bond | 62 ↔ 68 | Potential | |||||||||||||||
| Disulfide bond | 74 ↔ 102 | Potential | |||||||||||||||
| Disulfide bond | 106 ↔ 122 | Potential | |||||||||||||||
| Disulfide bond | 123 ↔ 128 | Potential | |||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 2 – 52 | 51 | TPLLT…TTRTS → QLGTGLLLAAVLSLQLA in isoform 3. | VSP_044157 | |||||||||||||
| Alternative sequence | 52 – 131 | 80 | SAAEA…LCNHD → YYTPTRMKVSKSCVPRCFET VYDGYSKHASTTSCCQYDLC NGTGLATPATLALAPILLAT LWGLL in isoform 2. | VSP_044158 | |||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Beta strand | 22 – 24 | 3 | |||||||||||||||
| Beta strand | 26 – 31 | 6 | |||||||||||||||
| Beta strand | 36 – 38 | 3 | |||||||||||||||
| Beta strand | 45 – 51 | 7 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris." Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H. Genomics 81:26-33(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY. Tissue: Skin. |
| [2] | "SLURP-2: a novel cholinergic signaling peptide in human mucocutaneous epithelium." Arredondo J., Chernyavsky A.I., Jolkovsky D.L., Webber R.J., Grando S.A. J. Cell. Physiol. 208:238-245(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INTERACTION WITH HETEROPENTAMERIC NACHRS, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | The MGC Project Team Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Pancreas. |
| [7] | Southan C., Simms M., Narjis S. Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORM 2). |
| [8] | "NMR structure and action on nicotinic acetylcholine receptors of water-soluble domain of human LYNX1." Lyukmanova E.N., Shenkarev Z.O., Shulepko M.A., Mineev K.S., D'Hoedt D., Kasheverov I.E., Filkin S.Y., Krivolapova A.P., Janickova H., Dolezal V., Dolgikh D.A., Arseniev A.S., Bertrand D., Tsetlin V.I., Kirpichnikov M.P. J. Biol. Chem. 286:10618-10627(2011) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 21-93 (ISOFORM 2). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB081838 mRNA. Translation: BAC56859.1. AY587277 mRNA. Translation: AAT00512.1. AY358417 mRNA. Translation: AAQ88783.1. AC083841 Genomic DNA. No translation available. CH471162 Genomic DNA. Translation: EAW82299.1. CH471162 Genomic DNA. Translation: EAW82301.1. CH471162 Genomic DNA. Translation: EAW82302.1. CH471162 Genomic DNA. Translation: EAW82303.1. CH471162 Genomic DNA. Translation: EAW82304.1. CH471162 Genomic DNA. Translation: EAW82306.1. BC032306 mRNA. No translation available. BQ685632 mRNA. No translation available. AF321824 mRNA. Translation: AAK01642.1. | ||||||||||||||||||
| IPI | IPI00289058. | ||||||||||||||||||
| RefSeq | NP_076435.1. NM_023946.2. NP_803252.1. NM_177457.3. NP_803253.1. NM_177458.1. NP_803429.1. NM_177476.2. NP_803430.1. NM_177477.2. | ||||||||||||||||||
| UniGene | Hs.158665. Hs.604828. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9BZG9. | ||||||||||||||||||
| SMR | Q9BZG9. Positions 21-47. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | 9606.ENSP00000337950. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| TCDB | 8.A.31.1.1. ly-6 neurotoxin-like Protein1 precursor (Lynx1) family. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 47117907. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9BZG9. | ||||||||||||||||||
| PeptideAtlas | Q9BZG9. | ||||||||||||||||||
| PRIDE | Q9BZG9. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000317543; ENSP00000319846; ENSG00000180155. ENST00000335822; ENSP00000337950; ENSG00000180155. ENST00000345173; ENSP00000332495; ENSG00000180155. ENST00000395192; ENSP00000378618; ENSG00000180155. ENST00000398906; ENSP00000381878; ENSG00000180155. | ||||||||||||||||||
| GeneID | 66004. | ||||||||||||||||||
| KEGG | hsa:66004. | ||||||||||||||||||
| UCSC | uc003yxa.3. human. uc003yxc.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 66004. | ||||||||||||||||||
| GeneCards | GC08M143844. | ||||||||||||||||||
| HGNC | HGNC:29604. LYNX1. | ||||||||||||||||||
| HPA | HPA023711. | ||||||||||||||||||
| MIM | 606110. gene. | ||||||||||||||||||
| neXtProt | NX_Q9BZG9. | ||||||||||||||||||
| PharmGKB | PA134874147. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG45102. | ||||||||||||||||||
| HOGENOM | HOG000035114. | ||||||||||||||||||
| HOVERGEN | HBG052377. | ||||||||||||||||||
| OMA | RTYYTPY. | ||||||||||||||||||
| PhylomeDB | Q9BZG9. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9BZG9. | ||||||||||||||||||
| Bgee | Q9BZG9. | ||||||||||||||||||
| CleanEx | HS_LYNX1. | ||||||||||||||||||
| Genevestigator | Q9BZG9. | ||||||||||||||||||
| GermOnline | ENSG00000180155. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR001526. LY6_UPAR. [Graphical view] | ||||||||||||||||||
| Pfam | PF00021. UPAR_LY6. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q9BZG9. | ||||||||||||||||||
| GenomeRNAi | 66004. | ||||||||||||||||||
| NextBio | 67514. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | LYNX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZG9 Secondary accession number(s): D3DWI7, G3XAC2, Q86SR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
