Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BZG9

- LYNX1_HUMAN

UniProt

Q9BZG9 - LYNX1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ly-6/neurotoxin-like protein 1

Gene

LYNX1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). In brain, isoform 2 modulates functional properties of nAChRs to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs (By similarity). Prevents plasticity in the primary visual cortex late in life (By similarity). In keratinocytes, isoform 3 delays differentiation and prevents apoptosis.By similarity1 Publication

Protein family/group databases

TCDBi8.A.31.1.1. the ly-6 neurotoxin-like protein1 precursor (lynx1) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Ly-6/neurotoxin-like protein 1
Alternative name(s):
Secreted Ly-6/uPAR domain-containing protein 2
Secreted Ly-6/uPAR-related protein 2
Short name:
SLURP-2
Gene namesi
Name:LYNX1
Synonyms:SLURP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:29604. LYNX1.

Subcellular locationi

Isoform 2 : Cell membrane Curated; Lipid-anchorGPI-anchor Curated. Cell projectiondendrite By similarity
Note: Detected in Purkinje cells soma and proximal dendrites.By similarity

GO - Cellular componenti

  1. anchored component of membrane Source: UniProtKB-KW
  2. cell projection Source: UniProtKB-KW
  3. extracellular vesicular exosome Source: UniProt
  4. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134874147.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Chaini21 – 131111Ly-6/neurotoxin-like protein 1PRO_0000036154Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi59 ↔ 81Sequence Analysis
Disulfide bondi62 ↔ 68Sequence Analysis
Disulfide bondi74 ↔ 102Sequence Analysis
Disulfide bondi106 ↔ 122Sequence Analysis
Disulfide bondi123 ↔ 128Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

MaxQBiQ9BZG9.
PaxDbiQ9BZG9.
PeptideAtlasiQ9BZG9.
PRIDEiQ9BZG9.

Expressioni

Tissue specificityi

Isoform 3 is expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level). Up-regulated 3-fold in psoriatic lesional skin. Detected in serum (at protein level).2 Publications

Gene expression databases

BgeeiQ9BZG9.
CleanExiHS_LYNX1.
ExpressionAtlasiQ9BZG9. baseline and differential.
GenevestigatoriQ9BZG9.

Organism-specific databases

HPAiHPA023711.

Interactioni

Subunit structurei

Isoform 2 interacts with nAChRs, including alpha4beta2 (CHRNA4/CHRNB2) and alpha7 (CHRNA7) (By similarity). Competes with alpha-bungarotoxin for nAChR alpha7 binding. Isoform 3 may interact with heteropentameric nAChRs expressed by keratinocytes.By similarity1 Publication

Protein-protein interaction databases

BioGridi122450. 2 interactions.
STRINGi9606.ENSP00000337950.

Structurei

Secondary structure

1
131
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi22 – 243Combined sources
Beta strandi26 – 316Combined sources
Beta strandi36 – 383Combined sources
Beta strandi45 – 517Combined sources
Beta strandi82 – 843Combined sources
Beta strandi87 – 893Combined sources
Beta strandi98 – 1047Combined sources
Beta strandi113 – 1153Combined sources
Beta strandi118 – 1236Combined sources
Turni126 – 1294Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1VYEmodel-A1-80[»]
2L03NMR-A21-129[»]
ProteinModelPortaliQ9BZG9.
SMRiQ9BZG9. Positions 21-47.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BZG9.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini59 – 12971UPAR/Ly6Add
BLAST

Sequence similaritiesi

Contains 1 UPAR/Ly6 domain.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG45102.
GeneTreeiENSGT00720000108940.
HOGENOMiHOG000035114.
HOVERGENiHBG052377.
InParanoidiQ9BZG9.
OMAiPYRMKVS.
PhylomeDBiQ9BZG9.

Family and domain databases

InterProiIPR001526. LY6_UPAR.
[Graphical view]
PfamiPF00021. UPAR_LY6. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BZG9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTPLLTLILV VLMGLPLAQA LDCHVCAYNG DNCFNPMRCP AMVAYCMTTR
60 70 80 90 100
TSAAEAIWCH QCTGFGGCSH GSRCLRDSTH CVTTATRVLS NTEDLPLVTK
110 120 130
MCHIGCPDIP SLGLGPYVSI ACCQTSLCNH D
Length:131
Mass (Da):14,026
Last modified:October 3, 2012 - v3
Checksum:iFAD1259D48A036D7
GO
Isoform 2 (identifier: Q9BZG9-2) [UniParc]FASTAAdd to Basket

Also known as: LYNX1

The sequence of this isoform differs from the canonical sequence as follows:
     52-131: SAAEAIWCHQ...CCQTSLCNHD → YYTPTRMKVS...ILLATLWGLL

Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).Curated

Show »
Length:116
Mass (Da):12,641
Checksum:iBF5827EB64BFE6F6
GO
Isoform 3 (identifier: Q9BZG9-3) [UniParc]FASTAAdd to Basket

Also known as: SLURP-2

The sequence of this isoform differs from the canonical sequence as follows:
     2-52: TPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTS → QLGTGLLLAAVLSLQLA

Show »
Length:97
Mass (Da):10,160
Checksum:i81719A103EC3001A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 5251TPLLT…TTRTS → QLGTGLLLAAVLSLQLA in isoform 3. 3 PublicationsVSP_044157Add
BLAST
Alternative sequencei52 – 13180SAAEA…LCNHD → YYTPTRMKVSKSCVPRCFET VYDGYSKHASTTSCCQYDLC NGTGLATPATLALAPILLAT LWGLL in isoform 2. 2 PublicationsVSP_044158Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB081838 mRNA. Translation: BAC56859.1.
AY587277 mRNA. Translation: AAT00512.1.
AY358417 mRNA. Translation: AAQ88783.1.
AC083841 Genomic DNA. No translation available.
CH471162 Genomic DNA. Translation: EAW82299.1.
CH471162 Genomic DNA. Translation: EAW82301.1.
CH471162 Genomic DNA. Translation: EAW82302.1.
CH471162 Genomic DNA. Translation: EAW82303.1.
CH471162 Genomic DNA. Translation: EAW82304.1.
CH471162 Genomic DNA. Translation: EAW82306.1.
BC032306 mRNA. No translation available.
BQ685632 mRNA. No translation available.
AF321824 mRNA. Translation: AAK01642.1.
CCDSiCCDS34951.1. [Q9BZG9-1]
CCDS34952.1. [Q9BZG9-3]
CCDS6389.1. [Q9BZG9-2]
RefSeqiNP_076435.1. NM_023946.2. [Q9BZG9-1]
NP_803252.1. NM_177457.3. [Q9BZG9-2]
NP_803253.1. NM_177458.1. [Q9BZG9-3]
NP_803429.1. NM_177476.2. [Q9BZG9-2]
NP_803430.1. NM_177477.2. [Q9BZG9-2]
UniGeneiHs.158665.
Hs.604828.

Genome annotation databases

EnsembliENST00000317543; ENSP00000319846; ENSG00000180155. [Q9BZG9-3]
ENST00000614491; ENSP00000477648; ENSG00000180155. [Q9BZG9-2]
ENST00000615007; ENSP00000479586; ENSG00000180155. [Q9BZG9-1]
ENST00000620006; ENSP00000478402; ENSG00000180155. [Q9BZG9-2]
ENST00000621401; ENSP00000478390; ENSG00000180155. [Q9BZG9-2]
GeneIDi66004.
KEGGihsa:66004.
UCSCiuc003yxa.3. human. [Q9BZG9-3]
uc003yxb.3. human. [Q9BZG9-1]
uc003yxc.1. human. [Q9BZG9-2]

Polymorphism databases

DMDMi408360254.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB081838 mRNA. Translation: BAC56859.1 .
AY587277 mRNA. Translation: AAT00512.1 .
AY358417 mRNA. Translation: AAQ88783.1 .
AC083841 Genomic DNA. No translation available.
CH471162 Genomic DNA. Translation: EAW82299.1 .
CH471162 Genomic DNA. Translation: EAW82301.1 .
CH471162 Genomic DNA. Translation: EAW82302.1 .
CH471162 Genomic DNA. Translation: EAW82303.1 .
CH471162 Genomic DNA. Translation: EAW82304.1 .
CH471162 Genomic DNA. Translation: EAW82306.1 .
BC032306 mRNA. No translation available.
BQ685632 mRNA. No translation available.
AF321824 mRNA. Translation: AAK01642.1 .
CCDSi CCDS34951.1. [Q9BZG9-1 ]
CCDS34952.1. [Q9BZG9-3 ]
CCDS6389.1. [Q9BZG9-2 ]
RefSeqi NP_076435.1. NM_023946.2. [Q9BZG9-1 ]
NP_803252.1. NM_177457.3. [Q9BZG9-2 ]
NP_803253.1. NM_177458.1. [Q9BZG9-3 ]
NP_803429.1. NM_177476.2. [Q9BZG9-2 ]
NP_803430.1. NM_177477.2. [Q9BZG9-2 ]
UniGenei Hs.158665.
Hs.604828.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1VYE model - A 1-80 [» ]
2L03 NMR - A 21-129 [» ]
ProteinModelPortali Q9BZG9.
SMRi Q9BZG9. Positions 21-47.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122450. 2 interactions.
STRINGi 9606.ENSP00000337950.

Protein family/group databases

TCDBi 8.A.31.1.1. the ly-6 neurotoxin-like protein1 precursor (lynx1) family.

Polymorphism databases

DMDMi 408360254.

Proteomic databases

MaxQBi Q9BZG9.
PaxDbi Q9BZG9.
PeptideAtlasi Q9BZG9.
PRIDEi Q9BZG9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317543 ; ENSP00000319846 ; ENSG00000180155 . [Q9BZG9-3 ]
ENST00000614491 ; ENSP00000477648 ; ENSG00000180155 . [Q9BZG9-2 ]
ENST00000615007 ; ENSP00000479586 ; ENSG00000180155 . [Q9BZG9-1 ]
ENST00000620006 ; ENSP00000478402 ; ENSG00000180155 . [Q9BZG9-2 ]
ENST00000621401 ; ENSP00000478390 ; ENSG00000180155 . [Q9BZG9-2 ]
GeneIDi 66004.
KEGGi hsa:66004.
UCSCi uc003yxa.3. human. [Q9BZG9-3 ]
uc003yxb.3. human. [Q9BZG9-1 ]
uc003yxc.1. human. [Q9BZG9-2 ]

Organism-specific databases

CTDi 66004.
GeneCardsi GC08M143844.
HGNCi HGNC:29604. LYNX1.
HPAi HPA023711.
MIMi 606110. gene.
neXtProti NX_Q9BZG9.
PharmGKBi PA134874147.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG45102.
GeneTreei ENSGT00720000108940.
HOGENOMi HOG000035114.
HOVERGENi HBG052377.
InParanoidi Q9BZG9.
OMAi PYRMKVS.
PhylomeDBi Q9BZG9.

Miscellaneous databases

EvolutionaryTracei Q9BZG9.
GeneWikii LYNX1.
GenomeRNAii 66004.
NextBioi 67514.
PROi Q9BZG9.
SOURCEi Search...

Gene expression databases

Bgeei Q9BZG9.
CleanExi HS_LYNX1.
ExpressionAtlasi Q9BZG9. baseline and differential.
Genevestigatori Q9BZG9.

Family and domain databases

InterProi IPR001526. LY6_UPAR.
[Graphical view ]
Pfami PF00021. UPAR_LY6. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris."
    Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H.
    Genomics 81:26-33(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
    Tissue: Skin.
  2. "SLURP-2: a novel cholinergic signaling peptide in human mucocutaneous epithelium."
    Arredondo J., Chernyavsky A.I., Jolkovsky D.L., Webber R.J., Grando S.A.
    J. Cell. Physiol. 208:238-245(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INTERACTION WITH HETEROPENTAMERIC NACHRS, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. The MGC Project Team
    Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Pancreas.
  7. Southan C., Simms M., Narjis S.
    Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORM 2).
  8. Cited for: STRUCTURE BY NMR OF 21-93 (ISOFORM 2).

Entry informationi

Entry nameiLYNX1_HUMAN
AccessioniPrimary (citable) accession number: Q9BZG9
Secondary accession number(s): D3DWI7, G3XAC2, Q86SR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 3, 2012
Last modified: November 26, 2014
This is version 104 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Isoform 2 is considered to be an endogenous "prototoxin", that shares a N-terminal three-finger structure with snake alpha-neurotoxins.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3