Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BZG9 (LYNX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ly-6/neurotoxin-like protein 1
Alternative name(s):
Secreted Ly-6/uPAR domain-containing protein 2
Secreted Ly-6/uPAR-related protein 2
Short name=SLURP-2
Gene names
Name:LYNX1
Synonyms:SLURP2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length131 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). In brain, isoform 2 modulates functional properties of nAChRs to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs By similarity. Prevents plasticity in the primary visual cortex late in life By similarity. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis. Ref.2

Subunit structure

Isoform 2 interacts with nAChRs, including alpha4beta2 (CHRNA4/CHRNB2) and alpha7 (CHRNA7) By similarity. Competes with alpha-bungarotoxin for nAChR alpha7 binding. Isoform 3 may interact with heteropentameric nAChRs expressed by keratinocytes. Ref.2

Subcellular location

Isoform 1: Secreted Potential Ref.2.

Isoform 2: Cell membrane; Lipid-anchorGPI-anchor Potential. Cell projectiondendrite By similarity. Note: Detected in Purkinje cells soma and proximal dendrites By similarity. Ref.2

Isoform 3: Secreted Ref.2.

Tissue specificity

Isoform 3 is expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level). Up-regulated 3-fold in psoriatic lesional skin. Detected in serum (at protein level). Ref.1 Ref.2

Miscellaneous

Isoform 2 is considered to be an endogenous "prototoxin", that shares a N-terminal three-finger structure with snake alpha-neurotoxins.

Sequence similarities

Contains 1 UPAR/Ly6 domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BZG9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BZG9-2)

Also known as: LYNX1;

The sequence of this isoform differs from the canonical sequence as follows:
     52-131: SAAEAIWCHQ...CCQTSLCNHD → YYTPTRMKVS...ILLATLWGLL
Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).
Isoform 3 (identifier: Q9BZG9-3)

Also known as: SLURP-2;

The sequence of this isoform differs from the canonical sequence as follows:
     2-52: TPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTS → QLGTGLLLAAVLSLQLA

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Potential
Chain21 – 131111Ly-6/neurotoxin-like protein 1
PRO_0000036154

Regions

Domain59 – 12971UPAR/Ly6

Amino acid modifications

Disulfide bond59 ↔ 81 Potential
Disulfide bond62 ↔ 68 Potential
Disulfide bond74 ↔ 102 Potential
Disulfide bond106 ↔ 122 Potential
Disulfide bond123 ↔ 128 Potential

Natural variations

Alternative sequence2 – 5251TPLLT…TTRTS → QLGTGLLLAAVLSLQLA in isoform 3.
VSP_044157
Alternative sequence52 – 13180SAAEA…LCNHD → YYTPTRMKVSKSCVPRCFET VYDGYSKHASTTSCCQYDLC NGTGLATPATLALAPILLAT LWGLL in isoform 2.
VSP_044158

Secondary structure

..................... 131
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 3, 2012. Version 3.
Checksum: FAD1259D48A036D7

FASTA13114,026
        10         20         30         40         50         60 
MTPLLTLILV VLMGLPLAQA LDCHVCAYNG DNCFNPMRCP AMVAYCMTTR TSAAEAIWCH 

        70         80         90        100        110        120 
QCTGFGGCSH GSRCLRDSTH CVTTATRVLS NTEDLPLVTK MCHIGCPDIP SLGLGPYVSI 

       130 
ACCQTSLCNH D 

« Hide

Isoform 2 (LYNX1) [UniParc].

Checksum: BF5827EB64BFE6F6
Show »

FASTA11612,641
Isoform 3 (SLURP-2) [UniParc].

Checksum: 81719A103EC3001A
Show »

FASTA9710,160

References

« Hide 'large scale' references
[1]"SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris."
Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H.
Genomics 81:26-33(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
Tissue: Skin.
[2]"SLURP-2: a novel cholinergic signaling peptide in human mucocutaneous epithelium."
Arredondo J., Chernyavsky A.I., Jolkovsky D.L., Webber R.J., Grando S.A.
J. Cell. Physiol. 208:238-245(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INTERACTION WITH HETEROPENTAMERIC NACHRS, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[4]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]The MGC Project Team
Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Pancreas.
[7]Southan C., Simms M., Narjis S.
Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORM 2).
[8]"NMR structure and action on nicotinic acetylcholine receptors of water-soluble domain of human LYNX1."
Lyukmanova E.N., Shenkarev Z.O., Shulepko M.A., Mineev K.S., D'Hoedt D., Kasheverov I.E., Filkin S.Y., Krivolapova A.P., Janickova H., Dolezal V., Dolgikh D.A., Arseniev A.S., Bertrand D., Tsetlin V.I., Kirpichnikov M.P.
J. Biol. Chem. 286:10618-10627(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 21-93 (ISOFORM 2).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB081838 mRNA. Translation: BAC56859.1.
AY587277 mRNA. Translation: AAT00512.1.
AY358417 mRNA. Translation: AAQ88783.1.
AC083841 Genomic DNA. No translation available.
CH471162 Genomic DNA. Translation: EAW82299.1.
CH471162 Genomic DNA. Translation: EAW82301.1.
CH471162 Genomic DNA. Translation: EAW82302.1.
CH471162 Genomic DNA. Translation: EAW82303.1.
CH471162 Genomic DNA. Translation: EAW82304.1.
CH471162 Genomic DNA. Translation: EAW82306.1.
BC032306 mRNA. No translation available.
BQ685632 mRNA. No translation available.
AF321824 mRNA. Translation: AAK01642.1.
RefSeqNP_076435.1. NM_023946.2.
NP_803252.1. NM_177457.3.
NP_803253.1. NM_177458.1.
NP_803429.1. NM_177476.2.
NP_803430.1. NM_177477.2.
UniGeneHs.158665.
Hs.604828.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1VYEmodel-A1-80[»]
2L03NMR-A21-93[»]
ProteinModelPortalQ9BZG9.
SMRQ9BZG9. Positions 20-130.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122450. 1 interaction.
STRING9606.ENSP00000337950.

Protein family/group databases

TCDB8.A.31.1.1. the ly-6 neurotoxin-like protein1 precursor (lynx1) family.

Polymorphism databases

DMDM408360254.

Proteomic databases

PaxDbQ9BZG9.
PeptideAtlasQ9BZG9.
PRIDEQ9BZG9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317543; ENSP00000319846; ENSG00000180155. [Q9BZG9-3]
ENST00000335822; ENSP00000337950; ENSG00000180155. [Q9BZG9-1]
ENST00000345173; ENSP00000332495; ENSG00000180155. [Q9BZG9-2]
ENST00000395192; ENSP00000378618; ENSG00000180155. [Q9BZG9-2]
ENST00000398906; ENSP00000381878; ENSG00000180155. [Q9BZG9-2]
GeneID66004.
KEGGhsa:66004.
UCSCuc003yxa.3. human. [Q9BZG9-3]
uc003yxb.3. human. [Q9BZG9-1]
uc003yxc.1. human. [Q9BZG9-2]

Organism-specific databases

CTD66004.
GeneCardsGC08M143844.
HGNCHGNC:29604. LYNX1.
HPAHPA023711.
MIM606110. gene.
neXtProtNX_Q9BZG9.
PharmGKBPA134874147.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG45102.
HOGENOMHOG000035114.
HOVERGENHBG052377.
OMAPYRMKVS.
PhylomeDBQ9BZG9.

Gene expression databases

ArrayExpressQ9BZG9.
BgeeQ9BZG9.
CleanExHS_LYNX1.
GenevestigatorQ9BZG9.

Family and domain databases

InterProIPR001526. LY6_UPAR.
[Graphical view]
PfamPF00021. UPAR_LY6. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9BZG9.
GeneWikiLYNX1.
GenomeRNAi66004.
NextBio67514.
PROQ9BZG9.
SOURCESearch...

Entry information

Entry nameLYNX1_HUMAN
AccessionPrimary (citable) accession number: Q9BZG9
Secondary accession number(s): D3DWI7, G3XAC2, Q86SR0
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 3, 2012
Last modified: April 16, 2014
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM