Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BZG9

- LYNX1_HUMAN

UniProt

Q9BZG9 - LYNX1_HUMAN

Protein

Ly-6/neurotoxin-like protein 1

Gene

LYNX1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs). In brain, isoform 2 modulates functional properties of nAChRs to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha4beta2 nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha4beta2 nAChRs By similarity. Prevents plasticity in the primary visual cortex late in life By similarity. In keratinocytes, isoform 3 delays differentiation and prevents apoptosis.By similarity1 Publication

    Protein family/group databases

    TCDBi8.A.31.1.1. the ly-6 neurotoxin-like protein1 precursor (lynx1) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ly-6/neurotoxin-like protein 1
    Alternative name(s):
    Secreted Ly-6/uPAR domain-containing protein 2
    Secreted Ly-6/uPAR-related protein 2
    Short name:
    SLURP-2
    Gene namesi
    Name:LYNX1
    Synonyms:SLURP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:29604. LYNX1.

    Subcellular locationi

    Isoform 2 : Cell membrane Curated; Lipid-anchorGPI-anchor Curated. Cell projectiondendrite By similarity
    Note: Detected in Purkinje cells soma and proximal dendrites.By similarity

    GO - Cellular componenti

    1. anchored component of membrane Source: UniProtKB-KW
    2. dendrite Source: UniProtKB-SubCell
    3. extracellular vesicular exosome Source: UniProt
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cell projection, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134874147.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Sequence AnalysisAdd
    BLAST
    Chaini21 – 131111Ly-6/neurotoxin-like protein 1PRO_0000036154Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi59 ↔ 81Sequence Analysis
    Disulfide bondi62 ↔ 68Sequence Analysis
    Disulfide bondi74 ↔ 102Sequence Analysis
    Disulfide bondi106 ↔ 122Sequence Analysis
    Disulfide bondi123 ↔ 128Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

    Proteomic databases

    MaxQBiQ9BZG9.
    PaxDbiQ9BZG9.
    PeptideAtlasiQ9BZG9.
    PRIDEiQ9BZG9.

    Expressioni

    Tissue specificityi

    Isoform 3 is expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level). Up-regulated 3-fold in psoriatic lesional skin. Detected in serum (at protein level).2 Publications

    Gene expression databases

    ArrayExpressiQ9BZG9.
    BgeeiQ9BZG9.
    CleanExiHS_LYNX1.
    GenevestigatoriQ9BZG9.

    Organism-specific databases

    HPAiHPA023711.

    Interactioni

    Subunit structurei

    Isoform 2 interacts with nAChRs, including alpha4beta2 (CHRNA4/CHRNB2) and alpha7 (CHRNA7) By similarity. Competes with alpha-bungarotoxin for nAChR alpha7 binding. Isoform 3 may interact with heteropentameric nAChRs expressed by keratinocytes.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi122450. 2 interactions.
    STRINGi9606.ENSP00000337950.

    Structurei

    Secondary structure

    1
    131
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi22 – 243
    Beta strandi26 – 316
    Beta strandi36 – 383
    Beta strandi45 – 517
    Beta strandi82 – 843
    Beta strandi87 – 893
    Beta strandi98 – 1047
    Beta strandi113 – 1153
    Beta strandi118 – 1236
    Turni126 – 1294

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1VYEmodel-A1-80[»]
    2L03NMR-A21-129[»]
    ProteinModelPortaliQ9BZG9.
    SMRiQ9BZG9. Positions 21-47.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9BZG9.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini59 – 12971UPAR/Ly6Add
    BLAST

    Sequence similaritiesi

    Contains 1 UPAR/Ly6 domain.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG45102.
    HOGENOMiHOG000035114.
    HOVERGENiHBG052377.
    OMAiPYRMKVS.
    PhylomeDBiQ9BZG9.

    Family and domain databases

    InterProiIPR001526. LY6_UPAR.
    [Graphical view]
    PfamiPF00021. UPAR_LY6. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BZG9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTPLLTLILV VLMGLPLAQA LDCHVCAYNG DNCFNPMRCP AMVAYCMTTR    50
    TSAAEAIWCH QCTGFGGCSH GSRCLRDSTH CVTTATRVLS NTEDLPLVTK 100
    MCHIGCPDIP SLGLGPYVSI ACCQTSLCNH D 131
    Length:131
    Mass (Da):14,026
    Last modified:October 3, 2012 - v3
    Checksum:iFAD1259D48A036D7
    GO
    Isoform 2 (identifier: Q9BZG9-2) [UniParc]FASTAAdd to Basket

    Also known as: LYNX1

    The sequence of this isoform differs from the canonical sequence as follows:
         52-131: SAAEAIWCHQ...CCQTSLCNHD → YYTPTRMKVS...ILLATLWGLL

    Note: Contains a potential GPI-anchor site at Gly-93. The propeptide 94-116 may be cleaved out upon GPI-anchor attachment (Potential).Curated

    Show »
    Length:116
    Mass (Da):12,641
    Checksum:iBF5827EB64BFE6F6
    GO
    Isoform 3 (identifier: Q9BZG9-3) [UniParc]FASTAAdd to Basket

    Also known as: SLURP-2

    The sequence of this isoform differs from the canonical sequence as follows:
         2-52: TPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTS → QLGTGLLLAAVLSLQLA

    Show »
    Length:97
    Mass (Da):10,160
    Checksum:i81719A103EC3001A
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 5251TPLLT…TTRTS → QLGTGLLLAAVLSLQLA in isoform 3. 3 PublicationsVSP_044157Add
    BLAST
    Alternative sequencei52 – 13180SAAEA…LCNHD → YYTPTRMKVSKSCVPRCFET VYDGYSKHASTTSCCQYDLC NGTGLATPATLALAPILLAT LWGLL in isoform 2. 2 PublicationsVSP_044158Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB081838 mRNA. Translation: BAC56859.1.
    AY587277 mRNA. Translation: AAT00512.1.
    AY358417 mRNA. Translation: AAQ88783.1.
    AC083841 Genomic DNA. No translation available.
    CH471162 Genomic DNA. Translation: EAW82299.1.
    CH471162 Genomic DNA. Translation: EAW82301.1.
    CH471162 Genomic DNA. Translation: EAW82302.1.
    CH471162 Genomic DNA. Translation: EAW82303.1.
    CH471162 Genomic DNA. Translation: EAW82304.1.
    CH471162 Genomic DNA. Translation: EAW82306.1.
    BC032306 mRNA. No translation available.
    BQ685632 mRNA. No translation available.
    AF321824 mRNA. Translation: AAK01642.1.
    CCDSiCCDS34951.1. [Q9BZG9-1]
    CCDS34952.1. [Q9BZG9-3]
    CCDS6389.1. [Q9BZG9-2]
    RefSeqiNP_076435.1. NM_023946.2. [Q9BZG9-1]
    NP_803252.1. NM_177457.3. [Q9BZG9-2]
    NP_803253.1. NM_177458.1. [Q9BZG9-3]
    NP_803429.1. NM_177476.2. [Q9BZG9-2]
    NP_803430.1. NM_177477.2. [Q9BZG9-2]
    UniGeneiHs.158665.
    Hs.604828.

    Genome annotation databases

    EnsembliENST00000317543; ENSP00000319846; ENSG00000180155. [Q9BZG9-3]
    GeneIDi66004.
    KEGGihsa:66004.
    UCSCiuc003yxa.3. human. [Q9BZG9-3]
    uc003yxb.3. human. [Q9BZG9-1]
    uc003yxc.1. human. [Q9BZG9-2]

    Polymorphism databases

    DMDMi408360254.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB081838 mRNA. Translation: BAC56859.1 .
    AY587277 mRNA. Translation: AAT00512.1 .
    AY358417 mRNA. Translation: AAQ88783.1 .
    AC083841 Genomic DNA. No translation available.
    CH471162 Genomic DNA. Translation: EAW82299.1 .
    CH471162 Genomic DNA. Translation: EAW82301.1 .
    CH471162 Genomic DNA. Translation: EAW82302.1 .
    CH471162 Genomic DNA. Translation: EAW82303.1 .
    CH471162 Genomic DNA. Translation: EAW82304.1 .
    CH471162 Genomic DNA. Translation: EAW82306.1 .
    BC032306 mRNA. No translation available.
    BQ685632 mRNA. No translation available.
    AF321824 mRNA. Translation: AAK01642.1 .
    CCDSi CCDS34951.1. [Q9BZG9-1 ]
    CCDS34952.1. [Q9BZG9-3 ]
    CCDS6389.1. [Q9BZG9-2 ]
    RefSeqi NP_076435.1. NM_023946.2. [Q9BZG9-1 ]
    NP_803252.1. NM_177457.3. [Q9BZG9-2 ]
    NP_803253.1. NM_177458.1. [Q9BZG9-3 ]
    NP_803429.1. NM_177476.2. [Q9BZG9-2 ]
    NP_803430.1. NM_177477.2. [Q9BZG9-2 ]
    UniGenei Hs.158665.
    Hs.604828.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1VYE model - A 1-80 [» ]
    2L03 NMR - A 21-129 [» ]
    ProteinModelPortali Q9BZG9.
    SMRi Q9BZG9. Positions 21-47.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122450. 2 interactions.
    STRINGi 9606.ENSP00000337950.

    Protein family/group databases

    TCDBi 8.A.31.1.1. the ly-6 neurotoxin-like protein1 precursor (lynx1) family.

    Polymorphism databases

    DMDMi 408360254.

    Proteomic databases

    MaxQBi Q9BZG9.
    PaxDbi Q9BZG9.
    PeptideAtlasi Q9BZG9.
    PRIDEi Q9BZG9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317543 ; ENSP00000319846 ; ENSG00000180155 . [Q9BZG9-3 ]
    GeneIDi 66004.
    KEGGi hsa:66004.
    UCSCi uc003yxa.3. human. [Q9BZG9-3 ]
    uc003yxb.3. human. [Q9BZG9-1 ]
    uc003yxc.1. human. [Q9BZG9-2 ]

    Organism-specific databases

    CTDi 66004.
    GeneCardsi GC08M143844.
    HGNCi HGNC:29604. LYNX1.
    HPAi HPA023711.
    MIMi 606110. gene.
    neXtProti NX_Q9BZG9.
    PharmGKBi PA134874147.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG45102.
    HOGENOMi HOG000035114.
    HOVERGENi HBG052377.
    OMAi PYRMKVS.
    PhylomeDBi Q9BZG9.

    Miscellaneous databases

    EvolutionaryTracei Q9BZG9.
    GeneWikii LYNX1.
    GenomeRNAii 66004.
    NextBioi 67514.
    PROi Q9BZG9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BZG9.
    Bgeei Q9BZG9.
    CleanExi HS_LYNX1.
    Genevestigatori Q9BZG9.

    Family and domain databases

    InterProi IPR001526. LY6_UPAR.
    [Graphical view ]
    Pfami PF00021. UPAR_LY6. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "SLURP-2, a novel member of the human Ly-6 superfamily that is up-regulated in psoriasis vulgaris."
      Tsuji H., Okamoto K., Matsuzaka Y., Iizuka H., Tamiya G., Inoko H.
      Genomics 81:26-33(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY.
      Tissue: Skin.
    2. "SLURP-2: a novel cholinergic signaling peptide in human mucocutaneous epithelium."
      Arredondo J., Chernyavsky A.I., Jolkovsky D.L., Webber R.J., Grando S.A.
      J. Cell. Physiol. 208:238-245(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INTERACTION WITH HETEROPENTAMERIC NACHRS, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. The MGC Project Team
      Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Pancreas.
    7. Southan C., Simms M., Narjis S.
      Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-80 (ISOFORM 2).
    8. Cited for: STRUCTURE BY NMR OF 21-93 (ISOFORM 2).

    Entry informationi

    Entry nameiLYNX1_HUMAN
    AccessioniPrimary (citable) accession number: Q9BZG9
    Secondary accession number(s): D3DWI7, G3XAC2, Q86SR0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2002
    Last sequence update: October 3, 2012
    Last modified: October 1, 2014
    This is version 102 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Isoform 2 is considered to be an endogenous "prototoxin", that shares a N-terminal three-finger structure with snake alpha-neurotoxins.

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3