Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BZF3

- OSBL6_HUMAN

UniProt

Q9BZF3 - OSBL6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Oxysterol-binding protein-related protein 6

Gene

OSBPL6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. lipid binding Source: UniProtKB-KW

GO - Biological processi

  1. lipid transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Oxysterol-binding protein-related protein 6
Short name:
ORP-6
Short name:
OSBP-related protein 6
Gene namesi
Name:OSBPL6
Synonyms:ORP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:16388. OSBPL6.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: BHF-UCL
  2. nuclear membrane Source: BHF-UCL
  3. perinuclear endoplasmic reticulum Source: BHF-UCL
  4. plasma membrane Source: BHF-UCL
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA32830.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 934933Oxysterol-binding protein-related protein 6PRO_0000100375Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9BZF3.
PaxDbiQ9BZF3.
PRIDEiQ9BZF3.

PTM databases

PhosphoSiteiQ9BZF3.

Expressioni

Tissue specificityi

Widely expressed.

Gene expression databases

BgeeiQ9BZF3.
CleanExiHS_OSBPL6.
GenevestigatoriQ9BZF3.

Organism-specific databases

HPAiHPA032131.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ORFQ9Q2G43EBI-2372709,EBI-6248094From a different organism.

Protein-protein interaction databases

BioGridi125381. 8 interactions.
IntActiQ9BZF3. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9BZF3.
SMRiQ9BZF3. Positions 582-899.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini86 – 18196PHPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the OSBP family.Curated
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG281324.
GeneTreeiENSGT00760000119155.
HOVERGENiHBG058934.
InParanoidiQ9BZF3.
OMAiVTIRNTK.
OrthoDBiEOG780RKR.
PhylomeDBiQ9BZF3.
TreeFamiTF320922.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR000648. Oxysterol-bd.
IPR018494. Oxysterol-bd_CS.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
[Graphical view]
PANTHERiPTHR10972. PTHR10972. 1 hit.
PfamiPF01237. Oxysterol_BP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
PROSITEiPS01013. OSBP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BZF3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSDEKGISP AHKTSTPTHR SASSSTSSQR DSRQSIHILE RTASSSTEPS
60 70 80 90 100
VSRQLLEPEP VPLSKEADSW EIIEGLKIGQ TNVQKPDKHE GFMLKKRKWP
110 120 130 140 150
LKGWHKRFFV LDNGMLKYSK APLDIQKGKV HGSIDVGLSV MSIKKKARRI
160 170 180 190 200
DLDTEEHIYH LKVKSQDWFD AWVSKLRHHR LYRQNEIVRS PRDASFHIFP
210 220 230 240 250
STSTAESSPA ANVSVMDGKM QPNSFPWQSP LPCSNSLPAT CTTGQSKVAA
260 270 280 290 300
WLQDSEEMDR CAEDLAHCQS NLVELSKLLQ NLEILQRTQS APNFTDMQAN
310 320 330 340 350
CVDISKKDKR VTRRWRTKSV SKDTKIQLQV PFSATMSPVR LHSSNPNLCA
360 370 380 390 400
DIEFQTPPSH LTDPLESSTD YTKLQEEFCL IAQKVHSLLK SAFNSIAIEK
410 420 430 440 450
EKLKQMVSEQ DHSKGHSTQM ARLRQSLSQA LNQNAELRSR LNRIHSESII
460 470 480 490 500
CDQVVSVNII PSPDEAGEQI HVSLPLSQQV ANESRLSMSE SVSEFFDAQE
510 520 530 540 550
VLLSASSSEN EASDDESYIS DVSDNISEDN TSVADNISRQ ILNGELTGGA
560 570 580 590 600
FRNGRRACLP APCPDTSNIN LWNILRNNIG KDLSKVSMPV ELNEPLNTLQ
610 620 630 640 650
HLCEEMEYSE LLDKASETDD PYERMVLVAA FAVSGYCSTY FRAGSKPFNP
660 670 680 690 700
VLGETYECIR EDKGFRFFSE QVSHHPPISA CHCESKNFVF WQDIRWKNKF
710 720 730 740 750
WGKSMEILPV GTLNVMLPKY GDYYVWNKVT TCIHNILSGR RWIEHYGEVT
760 770 780 790 800
IRNTKSSVCI CKLTFVKVNY WNSNMNEVQG VVIDQEGKAV YRLFGKWHEG
810 820 830 840 850
LYCGVAPSAK CIWRPGSMPT NYELYYGFTR FAIELNELDP VLKDLLPPTD
860 870 880 890 900
ARFRPDQRFL EEGNLEAAAS EKQRVEELQR SRRRYMEENN LEHIPKFFKK
910 920 930
VIDANQREAW VSNDTYWELR KDPGFSKVDS PVLW
Length:934
Mass (Da):106,306
Last modified:June 1, 2001 - v1
Checksum:iD20F90EA34C81497
GO
Isoform 2 (identifier: Q9BZF3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-466: Missing.

Show »
Length:898
Mass (Da):102,293
Checksum:iFDCF238AFD0D0B79
GO
Isoform 3 (identifier: Q9BZF3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQ → MHQLSLIRGNRGR
     329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

Show »
Length:938
Mass (Da):106,864
Checksum:i275936D5B48740FF
GO
Isoform 4 (identifier: Q9BZF3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-328: Missing.

Show »
Length:903
Mass (Da):102,635
Checksum:i612100E10BD6C501
GO
Isoform 5 (identifier: Q9BZF3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

Show »
Length:959
Mass (Da):108,959
Checksum:iD0D688B86FECA73D
GO
Isoform 6 (identifier: Q9BZF3-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-328: Missing.
     431-466: Missing.
     541-575: ILNGELTGGAFRNGRRACLPAPCPDTSNINLWNIL → SMHHLSFQVVLSTCQIATRRLNEQAFPLPRHPHPC
     576-934: Missing.

Note: No experimental confirmation available.

Show »
Length:508
Mass (Da):56,951
Checksum:iDF8ED83EB1DC131D
GO

Sequence cautioni

The sequence BAB55223.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAD92135.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti319 – 3191S → G in BAB55223. (PubMed:14702039)Curated
Sequence conflicti350 – 3501A → V in BAG62123. (PubMed:14702039)Curated
Sequence conflicti487 – 4871S → P in BAC04248. (PubMed:14702039)Curated
Sequence conflicti714 – 7141N → S in BAB55223. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti53 – 531R → Q.
Corresponds to variant rs35032920 [ dbSNP | Ensembl ].
VAR_057663
Natural varianti58 – 581P → L.
Corresponds to variant rs34874235 [ dbSNP | Ensembl ].
VAR_053550

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3434MSSDE…RDSRQ → MHQLSLIRGNRGR in isoform 3. 1 PublicationVSP_036559Add
BLAST
Alternative sequencei298 – 32831Missing in isoform 4 and isoform 6. 2 PublicationsVSP_036560Add
BLAST
Alternative sequencei329 – 3291Q → QEGPPAKGQFSTTRRRQRLA AAVATT in isoform 3 and isoform 5. 2 PublicationsVSP_036561
Alternative sequencei431 – 46636Missing in isoform 2 and isoform 6. 2 PublicationsVSP_010013Add
BLAST
Alternative sequencei541 – 57535ILNGE…LWNIL → SMHHLSFQVVLSTCQIATRR LNEQAFPLPRHPHPC in isoform 6. 1 PublicationVSP_054430Add
BLAST
Alternative sequencei576 – 934359Missing in isoform 6. 1 PublicationVSP_054431Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF323728 mRNA. Translation: AAG53409.1.
AF392448 mRNA. Translation: AAL40661.1.
AF462443 mRNA. Translation: AAP97711.1.
AK027600 mRNA. Translation: BAB55223.1. Different initiation.
AK093902 mRNA. Translation: BAC04248.1.
AK300389 mRNA. Translation: BAG62123.1.
AB208898 mRNA. Translation: BAD92135.1. Different initiation.
AC009948 Genomic DNA. Translation: AAX88881.1.
AC011743 Genomic DNA. Translation: AAY15090.1.
AC011238 Genomic DNA. No translation available.
CH471058 Genomic DNA. Translation: EAX11040.1.
CH471058 Genomic DNA. Translation: EAX11041.1.
CH471058 Genomic DNA. Translation: EAX11042.1.
CH471058 Genomic DNA. Translation: EAX11043.1.
BC052259 mRNA. Translation: AAH52259.1.
CCDSiCCDS2277.1. [Q9BZF3-1]
CCDS2278.1. [Q9BZF3-3]
CCDS56150.1. [Q9BZF3-5]
CCDS56151.1. [Q9BZF3-2]
CCDS56152.1. [Q9BZF3-4]
RefSeqiNP_001188409.1. NM_001201480.1. [Q9BZF3-5]
NP_001188410.1. NM_001201481.1. [Q9BZF3-4]
NP_001188411.1. NM_001201482.1. [Q9BZF3-2]
NP_115912.1. NM_032523.3. [Q9BZF3-1]
NP_665682.1. NM_145739.2. [Q9BZF3-3]
XP_005246325.1. XM_005246268.1. [Q9BZF3-6]
UniGeneiHs.318775.

Genome annotation databases

EnsembliENST00000190611; ENSP00000190611; ENSG00000079156. [Q9BZF3-1]
ENST00000315022; ENSP00000318723; ENSG00000079156. [Q9BZF3-3]
ENST00000357080; ENSP00000349591; ENSG00000079156. [Q9BZF3-6]
ENST00000359685; ENSP00000352713; ENSG00000079156. [Q9BZF3-2]
ENST00000392505; ENSP00000376293; ENSG00000079156. [Q9BZF3-5]
ENST00000409045; ENSP00000387248; ENSG00000079156. [Q9BZF3-4]
ENST00000409631; ENSP00000386885; ENSG00000079156. [Q9BZF3-2]
GeneIDi114880.
KEGGihsa:114880.
UCSCiuc002ulw.3. human.
uc002ulx.3. human. [Q9BZF3-1]
uc002uly.3. human. [Q9BZF3-5]
uc002ulz.3. human. [Q9BZF3-2]
uc002uma.3. human. [Q9BZF3-3]
uc010zfe.2. human. [Q9BZF3-4]

Polymorphism databases

DMDMi20139133.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF323728 mRNA. Translation: AAG53409.1 .
AF392448 mRNA. Translation: AAL40661.1 .
AF462443 mRNA. Translation: AAP97711.1 .
AK027600 mRNA. Translation: BAB55223.1 . Different initiation.
AK093902 mRNA. Translation: BAC04248.1 .
AK300389 mRNA. Translation: BAG62123.1 .
AB208898 mRNA. Translation: BAD92135.1 . Different initiation.
AC009948 Genomic DNA. Translation: AAX88881.1 .
AC011743 Genomic DNA. Translation: AAY15090.1 .
AC011238 Genomic DNA. No translation available.
CH471058 Genomic DNA. Translation: EAX11040.1 .
CH471058 Genomic DNA. Translation: EAX11041.1 .
CH471058 Genomic DNA. Translation: EAX11042.1 .
CH471058 Genomic DNA. Translation: EAX11043.1 .
BC052259 mRNA. Translation: AAH52259.1 .
CCDSi CCDS2277.1. [Q9BZF3-1 ]
CCDS2278.1. [Q9BZF3-3 ]
CCDS56150.1. [Q9BZF3-5 ]
CCDS56151.1. [Q9BZF3-2 ]
CCDS56152.1. [Q9BZF3-4 ]
RefSeqi NP_001188409.1. NM_001201480.1. [Q9BZF3-5 ]
NP_001188410.1. NM_001201481.1. [Q9BZF3-4 ]
NP_001188411.1. NM_001201482.1. [Q9BZF3-2 ]
NP_115912.1. NM_032523.3. [Q9BZF3-1 ]
NP_665682.1. NM_145739.2. [Q9BZF3-3 ]
XP_005246325.1. XM_005246268.1. [Q9BZF3-6 ]
UniGenei Hs.318775.

3D structure databases

ProteinModelPortali Q9BZF3.
SMRi Q9BZF3. Positions 582-899.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 125381. 8 interactions.
IntActi Q9BZF3. 3 interactions.

PTM databases

PhosphoSitei Q9BZF3.

Polymorphism databases

DMDMi 20139133.

Proteomic databases

MaxQBi Q9BZF3.
PaxDbi Q9BZF3.
PRIDEi Q9BZF3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000190611 ; ENSP00000190611 ; ENSG00000079156 . [Q9BZF3-1 ]
ENST00000315022 ; ENSP00000318723 ; ENSG00000079156 . [Q9BZF3-3 ]
ENST00000357080 ; ENSP00000349591 ; ENSG00000079156 . [Q9BZF3-6 ]
ENST00000359685 ; ENSP00000352713 ; ENSG00000079156 . [Q9BZF3-2 ]
ENST00000392505 ; ENSP00000376293 ; ENSG00000079156 . [Q9BZF3-5 ]
ENST00000409045 ; ENSP00000387248 ; ENSG00000079156 . [Q9BZF3-4 ]
ENST00000409631 ; ENSP00000386885 ; ENSG00000079156 . [Q9BZF3-2 ]
GeneIDi 114880.
KEGGi hsa:114880.
UCSCi uc002ulw.3. human.
uc002ulx.3. human. [Q9BZF3-1 ]
uc002uly.3. human. [Q9BZF3-5 ]
uc002ulz.3. human. [Q9BZF3-2 ]
uc002uma.3. human. [Q9BZF3-3 ]
uc010zfe.2. human. [Q9BZF3-4 ]

Organism-specific databases

CTDi 114880.
GeneCardsi GC02P179023.
HGNCi HGNC:16388. OSBPL6.
HPAi HPA032131.
MIMi 606734. gene.
neXtProti NX_Q9BZF3.
PharmGKBi PA32830.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG281324.
GeneTreei ENSGT00760000119155.
HOVERGENi HBG058934.
InParanoidi Q9BZF3.
OMAi VTIRNTK.
OrthoDBi EOG780RKR.
PhylomeDBi Q9BZF3.
TreeFami TF320922.

Miscellaneous databases

ChiTaRSi OSBPL6. human.
GenomeRNAii 114880.
NextBioi 79353.
PROi Q9BZF3.
SOURCEi Search...

Gene expression databases

Bgeei Q9BZF3.
CleanExi HS_OSBPL6.
Genevestigatori Q9BZF3.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
InterProi IPR000648. Oxysterol-bd.
IPR018494. Oxysterol-bd_CS.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
[Graphical view ]
PANTHERi PTHR10972. PTHR10972. 1 hit.
Pfami PF01237. Oxysterol_BP. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
[Graphical view ]
PROSITEi PS01013. OSBP. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The OSBP-related protein family in humans."
    Lehto M., Laitinen S., Chinetti G., Johansson M., Ehnholm C., Staels B., Ikonen E., Olkkonen V.M.
    J. Lipid Res. 42:1203-1213(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "A family of 12 human genes containing oxysterol-binding domains."
    Jaworski C.J., Moreira E., Li A., Lee R., Rodriguez I.R.
    Genomics 78:185-196(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Guo J.H., Zan Q., Yu L.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 195-934 (ISOFORM 1).
    Tissue: Placenta, Teratocarcinoma and Trachea.
  5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Brain.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Lung.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiOSBL6_HUMAN
AccessioniPrimary (citable) accession number: Q9BZF3
Secondary accession number(s): B4DTW1
, C4AMC0, C4AME4, D3DPF6, D3DPF7, Q4ZG68, Q53T68, Q59H61, Q7Z4Q1, Q86V84, Q8N9T0, Q96SR1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 2001
Last modified: October 29, 2014
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3