Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BZF3

- OSBL6_HUMAN

UniProt

Q9BZF3 - OSBL6_HUMAN

Protein

Oxysterol-binding protein-related protein 6

Gene

OSBPL6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. lipid binding Source: UniProtKB-KW
    2. protein binding Source: IntAct

    GO - Biological processi

    1. lipid transport Source: UniProtKB-KW

    Keywords - Biological processi

    Lipid transport, Transport

    Keywords - Ligandi

    Lipid-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Oxysterol-binding protein-related protein 6
    Short name:
    ORP-6
    Short name:
    OSBP-related protein 6
    Gene namesi
    Name:OSBPL6
    Synonyms:ORP6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:16388. OSBPL6.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: BHF-UCL
    2. nuclear membrane Source: BHF-UCL
    3. perinuclear endoplasmic reticulum Source: BHF-UCL
    4. plasma membrane Source: BHF-UCL

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA32830.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 934933Oxysterol-binding protein-related protein 6PRO_0000100375Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9BZF3.
    PaxDbiQ9BZF3.
    PRIDEiQ9BZF3.

    PTM databases

    PhosphoSiteiQ9BZF3.

    Expressioni

    Tissue specificityi

    Widely expressed.

    Gene expression databases

    ArrayExpressiQ9BZF3.
    BgeeiQ9BZF3.
    CleanExiHS_OSBPL6.
    GenevestigatoriQ9BZF3.

    Organism-specific databases

    HPAiHPA032131.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ORFQ9Q2G43EBI-2372709,EBI-6248094From a different organism.

    Protein-protein interaction databases

    BioGridi125381. 3 interactions.
    IntActiQ9BZF3. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BZF3.
    SMRiQ9BZF3. Positions 85-181, 562-934.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini86 – 18196PHPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the OSBP family.Curated
    Contains 1 PH domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG281324.
    HOVERGENiHBG058934.
    OMAiVTIRNTK.
    OrthoDBiEOG780RKR.
    PhylomeDBiQ9BZF3.
    TreeFamiTF320922.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR000648. Oxysterol-bd.
    IPR018494. Oxysterol-bd_CS.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    [Graphical view]
    PANTHERiPTHR10972. PTHR10972. 1 hit.
    PfamiPF01237. Oxysterol_BP. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    [Graphical view]
    PROSITEiPS01013. OSBP. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BZF3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSDEKGISP AHKTSTPTHR SASSSTSSQR DSRQSIHILE RTASSSTEPS    50
    VSRQLLEPEP VPLSKEADSW EIIEGLKIGQ TNVQKPDKHE GFMLKKRKWP 100
    LKGWHKRFFV LDNGMLKYSK APLDIQKGKV HGSIDVGLSV MSIKKKARRI 150
    DLDTEEHIYH LKVKSQDWFD AWVSKLRHHR LYRQNEIVRS PRDASFHIFP 200
    STSTAESSPA ANVSVMDGKM QPNSFPWQSP LPCSNSLPAT CTTGQSKVAA 250
    WLQDSEEMDR CAEDLAHCQS NLVELSKLLQ NLEILQRTQS APNFTDMQAN 300
    CVDISKKDKR VTRRWRTKSV SKDTKIQLQV PFSATMSPVR LHSSNPNLCA 350
    DIEFQTPPSH LTDPLESSTD YTKLQEEFCL IAQKVHSLLK SAFNSIAIEK 400
    EKLKQMVSEQ DHSKGHSTQM ARLRQSLSQA LNQNAELRSR LNRIHSESII 450
    CDQVVSVNII PSPDEAGEQI HVSLPLSQQV ANESRLSMSE SVSEFFDAQE 500
    VLLSASSSEN EASDDESYIS DVSDNISEDN TSVADNISRQ ILNGELTGGA 550
    FRNGRRACLP APCPDTSNIN LWNILRNNIG KDLSKVSMPV ELNEPLNTLQ 600
    HLCEEMEYSE LLDKASETDD PYERMVLVAA FAVSGYCSTY FRAGSKPFNP 650
    VLGETYECIR EDKGFRFFSE QVSHHPPISA CHCESKNFVF WQDIRWKNKF 700
    WGKSMEILPV GTLNVMLPKY GDYYVWNKVT TCIHNILSGR RWIEHYGEVT 750
    IRNTKSSVCI CKLTFVKVNY WNSNMNEVQG VVIDQEGKAV YRLFGKWHEG 800
    LYCGVAPSAK CIWRPGSMPT NYELYYGFTR FAIELNELDP VLKDLLPPTD 850
    ARFRPDQRFL EEGNLEAAAS EKQRVEELQR SRRRYMEENN LEHIPKFFKK 900
    VIDANQREAW VSNDTYWELR KDPGFSKVDS PVLW 934
    Length:934
    Mass (Da):106,306
    Last modified:June 1, 2001 - v1
    Checksum:iD20F90EA34C81497
    GO
    Isoform 2 (identifier: Q9BZF3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         431-466: Missing.

    Show »
    Length:898
    Mass (Da):102,293
    Checksum:iFDCF238AFD0D0B79
    GO
    Isoform 3 (identifier: Q9BZF3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQ → MHQLSLIRGNRGR
         329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

    Show »
    Length:938
    Mass (Da):106,864
    Checksum:i275936D5B48740FF
    GO
    Isoform 4 (identifier: Q9BZF3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         298-328: Missing.

    Show »
    Length:903
    Mass (Da):102,635
    Checksum:i612100E10BD6C501
    GO
    Isoform 5 (identifier: Q9BZF3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

    Show »
    Length:959
    Mass (Da):108,959
    Checksum:iD0D688B86FECA73D
    GO
    Isoform 6 (identifier: Q9BZF3-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         298-328: Missing.
         431-466: Missing.
         541-575: ILNGELTGGAFRNGRRACLPAPCPDTSNINLWNIL → SMHHLSFQVVLSTCQIATRRLNEQAFPLPRHPHPC
         576-934: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:508
    Mass (Da):56,951
    Checksum:iDF8ED83EB1DC131D
    GO

    Sequence cautioni

    The sequence BAB55223.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAD92135.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti319 – 3191S → G in BAB55223. (PubMed:14702039)Curated
    Sequence conflicti350 – 3501A → V in BAG62123. (PubMed:14702039)Curated
    Sequence conflicti487 – 4871S → P in BAC04248. (PubMed:14702039)Curated
    Sequence conflicti714 – 7141N → S in BAB55223. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti53 – 531R → Q.
    Corresponds to variant rs35032920 [ dbSNP | Ensembl ].
    VAR_057663
    Natural varianti58 – 581P → L.
    Corresponds to variant rs34874235 [ dbSNP | Ensembl ].
    VAR_053550

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3434MSSDE…RDSRQ → MHQLSLIRGNRGR in isoform 3. 1 PublicationVSP_036559Add
    BLAST
    Alternative sequencei298 – 32831Missing in isoform 4 and isoform 6. 2 PublicationsVSP_036560Add
    BLAST
    Alternative sequencei329 – 3291Q → QEGPPAKGQFSTTRRRQRLA AAVATT in isoform 3 and isoform 5. 2 PublicationsVSP_036561
    Alternative sequencei431 – 46636Missing in isoform 2 and isoform 6. 2 PublicationsVSP_010013Add
    BLAST
    Alternative sequencei541 – 57535ILNGE…LWNIL → SMHHLSFQVVLSTCQIATRR LNEQAFPLPRHPHPC in isoform 6. 1 PublicationVSP_054430Add
    BLAST
    Alternative sequencei576 – 934359Missing in isoform 6. 1 PublicationVSP_054431Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF323728 mRNA. Translation: AAG53409.1.
    AF392448 mRNA. Translation: AAL40661.1.
    AF462443 mRNA. Translation: AAP97711.1.
    AK027600 mRNA. Translation: BAB55223.1. Different initiation.
    AK093902 mRNA. Translation: BAC04248.1.
    AK300389 mRNA. Translation: BAG62123.1.
    AB208898 mRNA. Translation: BAD92135.1. Different initiation.
    AC009948 Genomic DNA. Translation: AAX88881.1.
    AC011743 Genomic DNA. Translation: AAY15090.1.
    AC011238 Genomic DNA. No translation available.
    CH471058 Genomic DNA. Translation: EAX11040.1.
    CH471058 Genomic DNA. Translation: EAX11041.1.
    CH471058 Genomic DNA. Translation: EAX11042.1.
    CH471058 Genomic DNA. Translation: EAX11043.1.
    BC052259 mRNA. Translation: AAH52259.1.
    CCDSiCCDS2277.1. [Q9BZF3-1]
    CCDS2278.1. [Q9BZF3-3]
    CCDS56150.1. [Q9BZF3-5]
    CCDS56151.1. [Q9BZF3-2]
    CCDS56152.1. [Q9BZF3-4]
    RefSeqiNP_001188409.1. NM_001201480.1. [Q9BZF3-5]
    NP_001188410.1. NM_001201481.1. [Q9BZF3-4]
    NP_001188411.1. NM_001201482.1. [Q9BZF3-2]
    NP_115912.1. NM_032523.3. [Q9BZF3-1]
    NP_665682.1. NM_145739.2. [Q9BZF3-3]
    XP_005246325.1. XM_005246268.1. [Q9BZF3-6]
    UniGeneiHs.318775.

    Genome annotation databases

    EnsembliENST00000190611; ENSP00000190611; ENSG00000079156. [Q9BZF3-1]
    ENST00000315022; ENSP00000318723; ENSG00000079156. [Q9BZF3-3]
    ENST00000357080; ENSP00000349591; ENSG00000079156. [Q9BZF3-6]
    ENST00000359685; ENSP00000352713; ENSG00000079156. [Q9BZF3-2]
    ENST00000392505; ENSP00000376293; ENSG00000079156. [Q9BZF3-5]
    ENST00000409045; ENSP00000387248; ENSG00000079156. [Q9BZF3-4]
    ENST00000409631; ENSP00000386885; ENSG00000079156. [Q9BZF3-2]
    GeneIDi114880.
    KEGGihsa:114880.
    UCSCiuc002ulx.3. human. [Q9BZF3-1]
    uc002uly.3. human. [Q9BZF3-5]
    uc002ulz.3. human. [Q9BZF3-2]
    uc002uma.3. human. [Q9BZF3-3]
    uc010zfe.2. human. [Q9BZF3-4]

    Polymorphism databases

    DMDMi20139133.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF323728 mRNA. Translation: AAG53409.1 .
    AF392448 mRNA. Translation: AAL40661.1 .
    AF462443 mRNA. Translation: AAP97711.1 .
    AK027600 mRNA. Translation: BAB55223.1 . Different initiation.
    AK093902 mRNA. Translation: BAC04248.1 .
    AK300389 mRNA. Translation: BAG62123.1 .
    AB208898 mRNA. Translation: BAD92135.1 . Different initiation.
    AC009948 Genomic DNA. Translation: AAX88881.1 .
    AC011743 Genomic DNA. Translation: AAY15090.1 .
    AC011238 Genomic DNA. No translation available.
    CH471058 Genomic DNA. Translation: EAX11040.1 .
    CH471058 Genomic DNA. Translation: EAX11041.1 .
    CH471058 Genomic DNA. Translation: EAX11042.1 .
    CH471058 Genomic DNA. Translation: EAX11043.1 .
    BC052259 mRNA. Translation: AAH52259.1 .
    CCDSi CCDS2277.1. [Q9BZF3-1 ]
    CCDS2278.1. [Q9BZF3-3 ]
    CCDS56150.1. [Q9BZF3-5 ]
    CCDS56151.1. [Q9BZF3-2 ]
    CCDS56152.1. [Q9BZF3-4 ]
    RefSeqi NP_001188409.1. NM_001201480.1. [Q9BZF3-5 ]
    NP_001188410.1. NM_001201481.1. [Q9BZF3-4 ]
    NP_001188411.1. NM_001201482.1. [Q9BZF3-2 ]
    NP_115912.1. NM_032523.3. [Q9BZF3-1 ]
    NP_665682.1. NM_145739.2. [Q9BZF3-3 ]
    XP_005246325.1. XM_005246268.1. [Q9BZF3-6 ]
    UniGenei Hs.318775.

    3D structure databases

    ProteinModelPortali Q9BZF3.
    SMRi Q9BZF3. Positions 85-181, 562-934.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 125381. 3 interactions.
    IntActi Q9BZF3. 3 interactions.

    PTM databases

    PhosphoSitei Q9BZF3.

    Polymorphism databases

    DMDMi 20139133.

    Proteomic databases

    MaxQBi Q9BZF3.
    PaxDbi Q9BZF3.
    PRIDEi Q9BZF3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000190611 ; ENSP00000190611 ; ENSG00000079156 . [Q9BZF3-1 ]
    ENST00000315022 ; ENSP00000318723 ; ENSG00000079156 . [Q9BZF3-3 ]
    ENST00000357080 ; ENSP00000349591 ; ENSG00000079156 . [Q9BZF3-6 ]
    ENST00000359685 ; ENSP00000352713 ; ENSG00000079156 . [Q9BZF3-2 ]
    ENST00000392505 ; ENSP00000376293 ; ENSG00000079156 . [Q9BZF3-5 ]
    ENST00000409045 ; ENSP00000387248 ; ENSG00000079156 . [Q9BZF3-4 ]
    ENST00000409631 ; ENSP00000386885 ; ENSG00000079156 . [Q9BZF3-2 ]
    GeneIDi 114880.
    KEGGi hsa:114880.
    UCSCi uc002ulx.3. human. [Q9BZF3-1 ]
    uc002uly.3. human. [Q9BZF3-5 ]
    uc002ulz.3. human. [Q9BZF3-2 ]
    uc002uma.3. human. [Q9BZF3-3 ]
    uc010zfe.2. human. [Q9BZF3-4 ]

    Organism-specific databases

    CTDi 114880.
    GeneCardsi GC02P179023.
    HGNCi HGNC:16388. OSBPL6.
    HPAi HPA032131.
    MIMi 606734. gene.
    neXtProti NX_Q9BZF3.
    PharmGKBi PA32830.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG281324.
    HOVERGENi HBG058934.
    OMAi VTIRNTK.
    OrthoDBi EOG780RKR.
    PhylomeDBi Q9BZF3.
    TreeFami TF320922.

    Miscellaneous databases

    ChiTaRSi OSBPL6. human.
    GenomeRNAii 114880.
    NextBioi 79353.
    PROi Q9BZF3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BZF3.
    Bgeei Q9BZF3.
    CleanExi HS_OSBPL6.
    Genevestigatori Q9BZF3.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR000648. Oxysterol-bd.
    IPR018494. Oxysterol-bd_CS.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    [Graphical view ]
    PANTHERi PTHR10972. PTHR10972. 1 hit.
    Pfami PF01237. Oxysterol_BP. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    [Graphical view ]
    PROSITEi PS01013. OSBP. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The OSBP-related protein family in humans."
      Lehto M., Laitinen S., Chinetti G., Johansson M., Ehnholm C., Staels B., Ikonen E., Olkkonen V.M.
      J. Lipid Res. 42:1203-1213(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "A family of 12 human genes containing oxysterol-binding domains."
      Jaworski C.J., Moreira E., Li A., Lee R., Rodriguez I.R.
      Genomics 78:185-196(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. Guo J.H., Zan Q., Yu L.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 195-934 (ISOFORM 1).
      Tissue: Placenta, Teratocarcinoma and Trachea.
    5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Brain.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Lung.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiOSBL6_HUMAN
    AccessioniPrimary (citable) accession number: Q9BZF3
    Secondary accession number(s): B4DTW1
    , C4AMC0, C4AME4, D3DPF6, D3DPF7, Q4ZG68, Q53T68, Q59H61, Q7Z4Q1, Q86V84, Q8N9T0, Q96SR1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 11, 2002
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3