Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Oxysterol-binding protein-related protein 6

Gene

OSBPL6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Weakly binds 25-hydroxycholesterol.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processLipid transport, Transport
LigandLipid-binding

Enzyme and pathway databases

ReactomeiR-HSA-192105 Synthesis of bile acids and bile salts

Names & Taxonomyi

Protein namesi
Recommended name:
Oxysterol-binding protein-related protein 6
Short name:
ORP-6
Short name:
OSBP-related protein 6
Gene namesi
Name:OSBPL6
Synonyms:ORP6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000079156.16
HGNCiHGNC:16388 OSBPL6
MIMi606734 gene
neXtProtiNX_Q9BZF3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi114880
OpenTargetsiENSG00000079156
PharmGKBiPA32830

Polymorphism and mutation databases

BioMutaiOSBPL6
DMDMi20139133

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001003752 – 934Oxysterol-binding protein-related protein 6Add BLAST933

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei35PhosphoserineCombined sources1
Modified residuei190PhosphoserineCombined sources1
Modified residuei290PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9BZF3
PaxDbiQ9BZF3
PeptideAtlasiQ9BZF3
PRIDEiQ9BZF3

PTM databases

iPTMnetiQ9BZF3
PhosphoSitePlusiQ9BZF3

Expressioni

Tissue specificityi

Expressed in brain and striated muscle (at protein level) (PubMed:14593528). Widely expressed (PubMed:11735225). Expressed in skeletal muscle (PubMed:14593528).

Developmental stagei

Expressed in fetal brain and lung.1 Publication

Gene expression databases

BgeeiENSG00000079156
CleanExiHS_OSBPL6
GenevisibleiQ9BZF3 HS

Organism-specific databases

HPAiHPA032131

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ORFQ9Q2G43EBI-2372709,EBI-6248094From Human immunodeficiency virus 1.

Protein-protein interaction databases

BioGridi125381, 51 interactors
ELMiQ9BZF3
IntActiQ9BZF3, 7 interactors
MINTiQ9BZF3
STRINGi9606.ENSP00000376293

Structurei

3D structure databases

ProteinModelPortaliQ9BZF3
SMRiQ9BZF3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini86 – 181PHPROSITE-ProRule annotationAdd BLAST96

Sequence similaritiesi

Belongs to the OSBP family.Curated

Phylogenomic databases

eggNOGiKOG1737 Eukaryota
ENOG410XP9E LUCA
GeneTreeiENSGT00760000119155
HOGENOMiHOG000231072
HOVERGENiHBG058934
InParanoidiQ9BZF3
KOiK20463
OMAiFVKGNYW
OrthoDBiEOG091G0DJB
PhylomeDBiQ9BZF3
TreeFamiTF320922

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR037239 OSBP_sf
IPR000648 Oxysterol-bd
IPR018494 Oxysterol-bd_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR10972 PTHR10972, 2 hits
PfamiView protein in Pfam
PF01237 Oxysterol_BP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SUPFAMiSSF144000 SSF144000, 1 hit
PROSITEiView protein in PROSITE
PS01013 OSBP, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BZF3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSDEKGISP AHKTSTPTHR SASSSTSSQR DSRQSIHILE RTASSSTEPS
60 70 80 90 100
VSRQLLEPEP VPLSKEADSW EIIEGLKIGQ TNVQKPDKHE GFMLKKRKWP
110 120 130 140 150
LKGWHKRFFV LDNGMLKYSK APLDIQKGKV HGSIDVGLSV MSIKKKARRI
160 170 180 190 200
DLDTEEHIYH LKVKSQDWFD AWVSKLRHHR LYRQNEIVRS PRDASFHIFP
210 220 230 240 250
STSTAESSPA ANVSVMDGKM QPNSFPWQSP LPCSNSLPAT CTTGQSKVAA
260 270 280 290 300
WLQDSEEMDR CAEDLAHCQS NLVELSKLLQ NLEILQRTQS APNFTDMQAN
310 320 330 340 350
CVDISKKDKR VTRRWRTKSV SKDTKIQLQV PFSATMSPVR LHSSNPNLCA
360 370 380 390 400
DIEFQTPPSH LTDPLESSTD YTKLQEEFCL IAQKVHSLLK SAFNSIAIEK
410 420 430 440 450
EKLKQMVSEQ DHSKGHSTQM ARLRQSLSQA LNQNAELRSR LNRIHSESII
460 470 480 490 500
CDQVVSVNII PSPDEAGEQI HVSLPLSQQV ANESRLSMSE SVSEFFDAQE
510 520 530 540 550
VLLSASSSEN EASDDESYIS DVSDNISEDN TSVADNISRQ ILNGELTGGA
560 570 580 590 600
FRNGRRACLP APCPDTSNIN LWNILRNNIG KDLSKVSMPV ELNEPLNTLQ
610 620 630 640 650
HLCEEMEYSE LLDKASETDD PYERMVLVAA FAVSGYCSTY FRAGSKPFNP
660 670 680 690 700
VLGETYECIR EDKGFRFFSE QVSHHPPISA CHCESKNFVF WQDIRWKNKF
710 720 730 740 750
WGKSMEILPV GTLNVMLPKY GDYYVWNKVT TCIHNILSGR RWIEHYGEVT
760 770 780 790 800
IRNTKSSVCI CKLTFVKVNY WNSNMNEVQG VVIDQEGKAV YRLFGKWHEG
810 820 830 840 850
LYCGVAPSAK CIWRPGSMPT NYELYYGFTR FAIELNELDP VLKDLLPPTD
860 870 880 890 900
ARFRPDQRFL EEGNLEAAAS EKQRVEELQR SRRRYMEENN LEHIPKFFKK
910 920 930
VIDANQREAW VSNDTYWELR KDPGFSKVDS PVLW
Length:934
Mass (Da):106,306
Last modified:June 1, 2001 - v1
Checksum:iD20F90EA34C81497
GO
Isoform 2 (identifier: Q9BZF3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-466: Missing.

Show »
Length:898
Mass (Da):102,293
Checksum:iFDCF238AFD0D0B79
GO
Isoform 3 (identifier: Q9BZF3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQ → MHQLSLIRGNRGR
     329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

Show »
Length:938
Mass (Da):106,864
Checksum:i275936D5B48740FF
GO
Isoform 4 (identifier: Q9BZF3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-328: Missing.

Show »
Length:903
Mass (Da):102,635
Checksum:i612100E10BD6C501
GO
Isoform 5 (identifier: Q9BZF3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

Show »
Length:959
Mass (Da):108,959
Checksum:iD0D688B86FECA73D
GO
Isoform 6 (identifier: Q9BZF3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-328: Missing.
     431-466: Missing.
     541-575: ILNGELTGGAFRNGRRACLPAPCPDTSNINLWNIL → SMHHLSFQVVLSTCQIATRRLNEQAFPLPRHPHPC
     576-934: Missing.

Note: No experimental confirmation available.
Show »
Length:508
Mass (Da):56,951
Checksum:iDF8ED83EB1DC131D
GO

Sequence cautioni

The sequence BAB55223 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92135 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti319S → G in BAB55223 (PubMed:14702039).Curated1
Sequence conflicti350A → V in BAG62123 (PubMed:14702039).Curated1
Sequence conflicti487S → P in BAC04248 (PubMed:14702039).Curated1
Sequence conflicti714N → S in BAB55223 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05766353R → Q. Corresponds to variant dbSNP:rs35032920Ensembl.1
Natural variantiVAR_05355058P → L. Corresponds to variant dbSNP:rs34874235Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0365591 – 34MSSDE…RDSRQ → MHQLSLIRGNRGR in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_036560298 – 328Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_036561329Q → QEGPPAKGQFSTTRRRQRLA AAVATT in isoform 3 and isoform 5. 2 Publications1
Alternative sequenceiVSP_010013431 – 466Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_054430541 – 575ILNGE…LWNIL → SMHHLSFQVVLSTCQIATRR LNEQAFPLPRHPHPC in isoform 6. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_054431576 – 934Missing in isoform 6. 1 PublicationAdd BLAST359

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF323728 mRNA Translation: AAG53409.1
AF392448 mRNA Translation: AAL40661.1
AF462443 mRNA Translation: AAP97711.1
AK027600 mRNA Translation: BAB55223.1 Different initiation.
AK093902 mRNA Translation: BAC04248.1
AK300389 mRNA Translation: BAG62123.1
AB208898 mRNA Translation: BAD92135.1 Different initiation.
AC009948 Genomic DNA Translation: AAX88881.1
AC011743 Genomic DNA Translation: AAY15090.1
AC011238 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11040.1
CH471058 Genomic DNA Translation: EAX11041.1
CH471058 Genomic DNA Translation: EAX11042.1
CH471058 Genomic DNA Translation: EAX11043.1
BC052259 mRNA Translation: AAH52259.1
CCDSiCCDS2277.1 [Q9BZF3-1]
CCDS2278.1 [Q9BZF3-3]
CCDS56150.1 [Q9BZF3-5]
CCDS56151.1 [Q9BZF3-2]
CCDS56152.1 [Q9BZF3-4]
RefSeqiNP_001188409.1, NM_001201480.1 [Q9BZF3-5]
NP_001188410.1, NM_001201481.1 [Q9BZF3-4]
NP_001188411.1, NM_001201482.1 [Q9BZF3-2]
NP_115912.1, NM_032523.3 [Q9BZF3-1]
NP_665682.1, NM_145739.2 [Q9BZF3-3]
XP_016858755.1, XM_017003266.1 [Q9BZF3-5]
XP_016858756.1, XM_017003267.1 [Q9BZF3-5]
XP_016858759.1, XM_017003270.1 [Q9BZF3-4]
XP_016858760.1, XM_017003271.1 [Q9BZF3-2]
UniGeneiHs.318775

Genome annotation databases

EnsembliENST00000190611; ENSP00000190611; ENSG00000079156 [Q9BZF3-1]
ENST00000315022; ENSP00000318723; ENSG00000079156 [Q9BZF3-3]
ENST00000357080; ENSP00000349591; ENSG00000079156 [Q9BZF3-6]
ENST00000359685; ENSP00000352713; ENSG00000079156 [Q9BZF3-2]
ENST00000392505; ENSP00000376293; ENSG00000079156 [Q9BZF3-5]
ENST00000409045; ENSP00000387248; ENSG00000079156 [Q9BZF3-4]
ENST00000409631; ENSP00000386885; ENSG00000079156 [Q9BZF3-2]
GeneIDi114880
KEGGihsa:114880
UCSCiuc002ulw.4 human [Q9BZF3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiOSBL6_HUMAN
AccessioniPrimary (citable) accession number: Q9BZF3
Secondary accession number(s): B4DTW1
, C4AMC0, C4AME4, D3DPF6, D3DPF7, Q4ZG68, Q53T68, Q59H61, Q7Z4Q1, Q86V84, Q8N9T0, Q96SR1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 2001
Last modified: May 23, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health