Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BZE9

- ASPC1_HUMAN

UniProt

Q9BZE9 - ASPC1_HUMAN

Protein

Tether containing UBX domain for GLUT4

Gene

ASPSCR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 99 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Tethering protein that sequesters GLUT4-containing vesicles in the cytoplasm in the absence of insulin. Modulates the amount of GLUT4 that is available at the cell surface By similarity. Enhances VCP methylation catalyzed by VCPKMT.By similarity1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei311 – 3122Breakpoint for translocation to form ASPSCR1-TFE3

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. glucose homeostasis Source: Ensembl
    2. intracellular protein transport Source: Ensembl
    3. membrane organization Source: Reactome
    4. regulation of glucose import Source: Ensembl

    Enzyme and pathway databases

    ReactomeiREACT_147867. Translocation of GLUT4 to the plasma membrane.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tether containing UBX domain for GLUT4
    Alternative name(s):
    Alveolar soft part sarcoma chromosomal region candidate gene 1 protein
    Alveolar soft part sarcoma locus
    Renal papillary cell carcinoma protein 17
    UBX domain-containing protein 9
    Gene namesi
    Name:ASPSCR1
    Synonyms:ASPL, RCC17, TUG, UBXD9, UBXN9
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:13825. ASPSCR1.

    Subcellular locationi

    Endomembrane system By similarity; Peripheral membrane protein By similarity. Cytoplasm 1 Publication. Nucleus 1 Publication

    GO - Cellular componenti

    1. cytoplasmic side of plasma membrane Source: Ensembl
    2. cytosol Source: Ensembl
    3. endomembrane system Source: UniProtKB-SubCell
    4. extrinsic component of membrane Source: Ensembl
    5. nucleus Source: UniProtKB-SubCell
    6. perinuclear region of cytoplasm Source: Ensembl
    7. vesicle membrane Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving ASPSCR1 is found in patients with alveolar soft part sarcoma. Translocation t(X;17)(p11;q25) with TFE3 forms a ASPSCR1-TFE3 fusion protein.
    A chromosomal aberration involving ASPSCR1 has been found in two patients with of papillary renal cell carcinoma. Translocation t(X;17)(p11.2;q25).

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    Orphaneti163699. Alveolar soft-tissue sarcoma.
    319308. Translocation renal cell carcinoma.
    PharmGKBiPA25058.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed2 Publications
    Chaini2 – 553552Tether containing UBX domain for GLUT4PRO_0000249885Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine2 Publications
    Modified residuei500 – 5001Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9BZE9.
    PaxDbiQ9BZE9.
    PRIDEiQ9BZE9.

    PTM databases

    PhosphoSiteiQ9BZE9.

    Expressioni

    Tissue specificityi

    Ubiquitous. Highly expressed in testis, heart, skeletal muscle and pancreas.2 Publications

    Gene expression databases

    ArrayExpressiQ9BZE9.
    BgeeiQ9BZE9.
    CleanExiHS_ASPSCR1.
    GenevestigatoriQ9BZE9.

    Organism-specific databases

    HPAiHPA026749.

    Interactioni

    Subunit structurei

    Interacts with GLUT4 By similarity. Interacts with VCPKMT.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    VCPP550723EBI-1993677,EBI-355164

    Protein-protein interaction databases

    BioGridi122516. 14 interactions.
    IntActiQ9BZE9. 4 interactions.
    MINTiMINT-4650542.
    STRINGi9606.ENSP00000302176.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BZE9.
    SMRiQ9BZE9. Positions 10-85.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini386 – 46277UBXPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni317 – 38064Interaction with GLUT4By similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 1 UBX domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG317887.
    HOGENOMiHOG000231241.
    HOVERGENiHBG066860.
    KOiK15627.
    OMAiCIYMRDE.
    OrthoDBiEOG7S7SF9.
    PhylomeDBiQ9BZE9.
    TreeFamiTF320363.

    Family and domain databases

    InterProiIPR021569. TUG/UBX4.
    IPR029071. Ubiquitin-rel_dom.
    IPR001012. UBX_dom.
    [Graphical view]
    PfamiPF11470. TUG-UBL1. 1 hit.
    PF00789. UBX. 1 hit.
    [Graphical view]
    SMARTiSM00166. UBX. 1 hit.
    [Graphical view]
    SUPFAMiSSF54236. SSF54236. 2 hits.
    PROSITEiPS50033. UBX. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BZE9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAPAGGGGS AVSVLAPNGR RHTVKVTPST VLLQVLEDTC RRQDFNPCEY    50
    DLKFQRSVLD LSLQWRFANL PNNAKLEMVP ASRSREGPEN MVRIALQLDD 100
    GSRLQDSFCS GQTLWELLSH FPQIRECLQH PGGATPVCVY TRDEVTGEAA 150
    LRGTTLQSLG LTGGSATIRF VMKCYDPVGK TPGSLGSSAS AGQAAASAPL 200
    PLESGELSRG DLSRPEDADT SGPCCEHTQE KQSTRAPAAA PFVPFSGGGQ 250
    RLGGPPGPTR PLTSSSAKLP KSLSSPGGPS KPKKSKSGQD PQQEQEQERE 300
    RDPQQEQERE RPVDREPVDR EPVVCHPDLE ERLQAWPAEL PDEFFELTVD 350
    DVRRRLAQLK SERKRLEEAP LVTKAFREAQ IKEKLERYPK VALRVLFPDR 400
    YVLQGFFRPS ETVGDLRDFV RSHLGNPELS FYLFITPPKT VLDDHTQTLF 450
    QANLFPAALV HLGAEEPAGV YLEPGLLEHA ISPSAADVLV ARYMSRAAGS 500
    PSPLPAPDPA PKSEPAAEEG ALVPPEPIPG TAQPVKRSLG KVPKWLKLPA 550
    SKR 553
    Length:553
    Mass (Da):60,183
    Last modified:June 1, 2001 - v1
    Checksum:iB013FDF9A48D2E5E
    GO
    Isoform 2 (identifier: Q9BZE9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         451-451: Q → QPQLGDRVAP...AGHKHVGTGR

    Show »
    Length:647
    Mass (Da):69,990
    Checksum:i27A49239AB88E6AE
    GO
    Isoform 3 (identifier: Q9BZE9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-77: Missing.
         434-434: F → CLSSFGRMDGRGPRCFLTRRCLLSSV

    Show »
    Length:501
    Mass (Da):54,485
    Checksum:i46B09A36E32F6EA5
    GO
    Isoform 4 (identifier: Q9BZE9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-77: Missing.
         390-425: KVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLG → RRSLSLSPRLESVVPSQLTASSASRVQVVLLPQPPK
         426-553: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:348
    Mass (Da):37,910
    Checksum:iE6CE5BE09E14AA97
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti257 – 2571G → E in BAB71595. (PubMed:14702039)Curated
    Sequence conflicti444 – 4441D → G in BAB71595. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti252 – 2521L → Q.2 Publications
    Corresponds to variant rs8074498 [ dbSNP | Ensembl ].
    VAR_027503
    Natural varianti318 – 3181V → M.
    Corresponds to variant rs34085048 [ dbSNP | Ensembl ].
    VAR_034745
    Natural varianti487 – 4871D → E.
    Corresponds to variant rs13087 [ dbSNP | Ensembl ].
    VAR_027504

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7777Missing in isoform 3 and isoform 4. 2 PublicationsVSP_020574Add
    BLAST
    Alternative sequencei390 – 42536KVALR…RSHLG → RRSLSLSPRLESVVPSQLTA SSASRVQVVLLPQPPK in isoform 4. 1 PublicationVSP_020575Add
    BLAST
    Alternative sequencei426 – 553128Missing in isoform 4. 1 PublicationVSP_020576Add
    BLAST
    Alternative sequencei434 – 4341F → CLSSFGRMDGRGPRCFLTRR CLLSSV in isoform 3. 1 PublicationVSP_020577
    Alternative sequencei451 – 4511Q → QPQLGDRVAPFTLGPSLKRC LGPEQRTRLPVVGDGGDVDS GRLLFWGPSRGRASPSTGQP PCHPVCRPSSPPSPRPSSGD PSRVKAGHKHVGTGR in isoform 2. 1 PublicationVSP_020578

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF324219 mRNA. Translation: AAK08959.2.
    AK057403 mRNA. Translation: BAB71472.1.
    AK057851 mRNA. Translation: BAB71595.1.
    AK290624 mRNA. Translation: BAF83313.1.
    BC006152 mRNA. Translation: AAH06152.1.
    BC018722 mRNA. Translation: AAH18722.1.
    CCDSiCCDS11796.1. [Q9BZE9-1]
    CCDS58611.1. [Q9BZE9-2]
    RefSeqiNP_001238817.1. NM_001251888.1. [Q9BZE9-2]
    NP_076988.1. NM_024083.3. [Q9BZE9-1]
    UniGeneiHs.298351.

    Genome annotation databases

    EnsembliENST00000306729; ENSP00000306625; ENSG00000169696. [Q9BZE9-2]
    ENST00000306739; ENSP00000302176; ENSG00000169696. [Q9BZE9-1]
    ENST00000580534; ENSP00000462329; ENSG00000169696. [Q9BZE9-3]
    GeneIDi79058.
    KEGGihsa:79058.
    UCSCiuc002kcx.3. human. [Q9BZE9-1]
    uc002kcy.3. human. [Q9BZE9-2]
    uc002kda.3. human. [Q9BZE9-3]

    Polymorphism databases

    DMDMi74717746.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF324219 mRNA. Translation: AAK08959.2 .
    AK057403 mRNA. Translation: BAB71472.1 .
    AK057851 mRNA. Translation: BAB71595.1 .
    AK290624 mRNA. Translation: BAF83313.1 .
    BC006152 mRNA. Translation: AAH06152.1 .
    BC018722 mRNA. Translation: AAH18722.1 .
    CCDSi CCDS11796.1. [Q9BZE9-1 ]
    CCDS58611.1. [Q9BZE9-2 ]
    RefSeqi NP_001238817.1. NM_001251888.1. [Q9BZE9-2 ]
    NP_076988.1. NM_024083.3. [Q9BZE9-1 ]
    UniGenei Hs.298351.

    3D structure databases

    ProteinModelPortali Q9BZE9.
    SMRi Q9BZE9. Positions 10-85.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122516. 14 interactions.
    IntActi Q9BZE9. 4 interactions.
    MINTi MINT-4650542.
    STRINGi 9606.ENSP00000302176.

    PTM databases

    PhosphoSitei Q9BZE9.

    Polymorphism databases

    DMDMi 74717746.

    Proteomic databases

    MaxQBi Q9BZE9.
    PaxDbi Q9BZE9.
    PRIDEi Q9BZE9.

    Protocols and materials databases

    DNASUi 79058.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000306729 ; ENSP00000306625 ; ENSG00000169696 . [Q9BZE9-2 ]
    ENST00000306739 ; ENSP00000302176 ; ENSG00000169696 . [Q9BZE9-1 ]
    ENST00000580534 ; ENSP00000462329 ; ENSG00000169696 . [Q9BZE9-3 ]
    GeneIDi 79058.
    KEGGi hsa:79058.
    UCSCi uc002kcx.3. human. [Q9BZE9-1 ]
    uc002kcy.3. human. [Q9BZE9-2 ]
    uc002kda.3. human. [Q9BZE9-3 ]

    Organism-specific databases

    CTDi 79058.
    GeneCardsi GC17P079935.
    H-InvDB HIX0022398.
    HGNCi HGNC:13825. ASPSCR1.
    HPAi HPA026749.
    MIMi 606236. gene.
    neXtProti NX_Q9BZE9.
    Orphaneti 163699. Alveolar soft-tissue sarcoma.
    319308. Translocation renal cell carcinoma.
    PharmGKBi PA25058.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG317887.
    HOGENOMi HOG000231241.
    HOVERGENi HBG066860.
    KOi K15627.
    OMAi CIYMRDE.
    OrthoDBi EOG7S7SF9.
    PhylomeDBi Q9BZE9.
    TreeFami TF320363.

    Enzyme and pathway databases

    Reactomei REACT_147867. Translocation of GLUT4 to the plasma membrane.

    Miscellaneous databases

    ChiTaRSi ASPSCR1. human.
    GeneWikii ASPSCR1.
    GenomeRNAii 79058.
    NextBioi 67822.
    PROi Q9BZE9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BZE9.
    Bgeei Q9BZE9.
    CleanExi HS_ASPSCR1.
    Genevestigatori Q9BZE9.

    Family and domain databases

    InterProi IPR021569. TUG/UBX4.
    IPR029071. Ubiquitin-rel_dom.
    IPR001012. UBX_dom.
    [Graphical view ]
    Pfami PF11470. TUG-UBL1. 1 hit.
    PF00789. UBX. 1 hit.
    [Graphical view ]
    SMARTi SM00166. UBX. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54236. SSF54236. 2 hits.
    PROSITEi PS50033. UBX. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The der(17)t(X;17)(p11;q25) of human alveolar soft part sarcoma fuses the TFE3 transcription factor gene to ASPL, a novel gene at 17q25."
      Ladanyi M., Lui M.Y., Antonescu C.R., Krause-Boehm A., Meindl A., Argani P., Healey J.H., Ueda T., Yoshikawa H., Meloni-Ehrig A., Sorensen P.H.B., Mertens F., Mandahl N., van den Berghe H., Sciot R., Dal Cin P., Bridge J.
      Oncogene 20:48-57(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH TFE3, TISSUE SPECIFICITY, INVOLVEMENT IN ASPS.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT GLN-252.
      Tissue: Brain, Heart and Testis.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT GLN-252.
      Tissue: Eye and Skin.
    4. "Fusion of a novel gene, RCC17, to the TFE3 gene in t(X;17)(p11.2;q25.3)-bearing papillary renal cell carcinomas."
      Heimann P., El Housni H., Ogur G., Weterman M.A.J., Petty E.M., Vassart G.
      Cancer Res. 61:4130-4135(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHROMOSOMAL TRANSLOCATION WITH TFE3, TISSUE SPECIFICITY.
    5. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-500, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    9. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity."
      Cloutier P., Lavallee-Adam M., Faubert D., Blanchette M., Coulombe B.
      PLoS Genet. 9:E1003210-E1003210(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN VCP METHYLATION, INTERACTION WITH VCPKMT, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiASPC1_HUMAN
    AccessioniPrimary (citable) accession number: Q9BZE9
    Secondary accession number(s): A8K3K9
    , Q7Z6N7, Q8WV59, Q96LS5, Q96M40
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 99 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3