Q9BZE9 (ASPC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tether containing UBX domain for GLUT4 Alternative name(s): Alveolar soft part sarcoma chromosomal region candidate gene 1 protein Alveolar soft part sarcoma locus Renal papillary cell carcinoma protein 17 UBX domain-containing protein 9 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 553 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tethering protein that sequesters GLUT4-containing vesicles in the cytoplasm in the absence of insulin. Modulates the amount of GLUT4 that is available at the cell surface By similarity. |
| Subunit structure | Interacts with GLUT4 By similarity. |
| Subcellular location | Endomembrane system; Peripheral membrane protein By similarity. |
| Tissue specificity | Ubiquitous. Highly expressed in testis, heart, skeletal muscle and pancreas. Ref.1 Ref.4 |
| Involvement in disease | A chromosomal aberration involving ASPSCR1 is found in patients with alveolar soft part sarcoma. Translocation t(X;17)(p11;q25) with TFE3 forms a ASPSCR1-TFE3 fusion protein. A chromosomal aberration involving ASPSCR1 has been found in two patients with of papillary renal cell carcinoma. Translocation t(X;17)(p11.2;q25). |
| Sequence similarities | Contains 1 UBX domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Disease | Proto-oncogene |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | glucose homeostasis Inferred from electronic annotation. Source: Compara intracellular protein transportInferred from electronic annotation. Source: Compara regulation of glucose importInferred from electronic annotation. Source: Compara |
| Cellular_component | cytosol Inferred from electronic annotation. Source: Compara extrinsic to membraneInferred from electronic annotation. Source: Compara internal side of plasma membraneInferred from electronic annotation. Source: Compara perinuclear region of cytoplasmInferred from electronic annotation. Source: Compara vesicle membraneInferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| VCP | P55072 | 2 | EBI-1993677,EBI-355164 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZE9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZE9-2) The sequence of this isoform differs from the canonical sequence as follows: 451-451: Q → QPQLGDRVAP...AGHKHVGTGR | ||||||
| Isoform 3 (identifier: Q9BZE9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-77: Missing. 434-434: F → CLSSFGRMDGRGPRCFLTRRCLLSSV | ||||||
| Isoform 4 (identifier: Q9BZE9-4) The sequence of this isoform differs from the canonical sequence as follows: 1-77: Missing. 390-425: KVALRVLFPDRYVLQGFFRPSETVGDLRDFVRSHLG → RRSLSLSPRLESVVPSQLTASSASRVQVVLLPQPPK 426-553: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 553 | 553 | Tether containing UBX domain for GLUT4 | PRO_0000249885 | |||||
Regions | |||||||||
| Domain | 386 – 462 | 77 | UBX | ||||||
| Region | 317 – 380 | 64 | Interaction with GLUT4 By similarity | ||||||
Sites | |||||||||
| Site | 311 – 312 | 2 | Breakpoint for translocation to form ASPSCR1-TFE3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 500 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 77 | 77 | Missing in isoform 3 and isoform 4. | VSP_020574 | |||||
| Alternative sequence | 390 – 425 | 36 | KVALR…RSHLG → RRSLSLSPRLESVVPSQLTA SSASRVQVVLLPQPPK in isoform 4. | VSP_020575 | |||||
| Alternative sequence | 426 – 553 | 128 | Missing in isoform 4. | VSP_020576 | |||||
| Alternative sequence | 434 | 1 | F → CLSSFGRMDGRGPRCFLTRR CLLSSV in isoform 3. | VSP_020577 | |||||
| Alternative sequence | 451 | 1 | Q → QPQLGDRVAPFTLGPSLKRC LGPEQRTRLPVVGDGGDVDS GRLLFWGPSRGRASPSTGQP PCHPVCRPSSPPSPRPSSGD PSRVKAGHKHVGTGR in isoform 2. | VSP_020578 | |||||
| Natural variant | 252 | 1 | L → Q. Ref.2 Ref.3 Corresponds to variant rs8074498 [ dbSNP | Ensembl ]. | VAR_027503 | |||||
| Natural variant | 318 | 1 | V → M. Corresponds to variant rs34085048 [ dbSNP | Ensembl ]. | VAR_034745 | |||||
| Natural variant | 487 | 1 | D → E. Corresponds to variant rs13087 [ dbSNP | Ensembl ]. | VAR_027504 | |||||
Experimental info | |||||||||
| Sequence conflict | 257 | 1 | G → E in BAB71595. Ref.2 | ||||||
| Sequence conflict | 444 | 1 | D → G in BAB71595. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The der(17)t(X;17)(p11;q25) of human alveolar soft part sarcoma fuses the TFE3 transcription factor gene to ASPL, a novel gene at 17q25." Ladanyi M., Lui M.Y., Antonescu C.R., Krause-Boehm A., Meindl A., Argani P., Healey J.H., Ueda T., Yoshikawa H., Meloni-Ehrig A., Sorensen P.H.B., Mertens F., Mandahl N., van den Berghe H., Sciot R., Dal Cin P., Bridge J. Oncogene 20:48-57(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH TFE3, TISSUE SPECIFICITY, INVOLVEMENT IN ASPS. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT GLN-252. Tissue: Brain, Heart and Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANT GLN-252. Tissue: Eye and Skin. |
| [4] | "Fusion of a novel gene, RCC17, to the TFE3 gene in t(X;17)(p11.2;q25.3)-bearing papillary renal cell carcinomas." Heimann P., El Housni H., Ogur G., Weterman M.A.J., Petty E.M., Vassart G. Cancer Res. 61:4130-4135(2001) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH TFE3, TISSUE SPECIFICITY. |
| [5] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [6] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-500, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF324219 mRNA. Translation: AAK08959.2. AK057403 mRNA. Translation: BAB71472.1. AK057851 mRNA. Translation: BAB71595.1. AK290624 mRNA. Translation: BAF83313.1. BC006152 mRNA. Translation: AAH06152.1. BC018722 mRNA. Translation: AAH18722.1. |
| IPI | IPI00065276. IPI00332071. IPI00385430. IPI00787285. |
| RefSeq | NP_001238817.1. NM_001251888.1. NP_076988.1. NM_024083.3. |
| UniGene | Hs.298351. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2AL3 based on UniProtKB Q8VBT9. |
| ProteinModelPortal | Q9BZE9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BZE9. 3 interactions. |
| STRING | 9606.ENSP00000302176. |
PTM databases | |
| PhosphoSite | Q9BZE9. |
Polymorphism databases | |
| DMDM | 74717746. |
Proteomic databases | |
| PaxDb | Q9BZE9. |
| PRIDE | Q9BZE9. |
Protocols and materials databases | |
| DNASU | 79058. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000306729; ENSP00000306625; ENSG00000169696. ENST00000306739; ENSP00000302176; ENSG00000169696. ENST00000580534; ENSP00000462329; ENSG00000169696. |
| GeneID | 79058. |
| KEGG | hsa:79058. |
| UCSC | uc002kcx.3. human. uc002kcy.3. human. uc002kda.3. human. |
Organism-specific databases | |
| CTD | 79058. |
| GeneCards | GC17P079935. |
| H-InvDB | HIX0022398. |
| HGNC | HGNC:13825. ASPSCR1. |
| HPA | HPA026749. |
| MIM | 606236. gene. |
| neXtProt | NX_Q9BZE9. |
| Orphanet | 163699. Alveolar soft-part sarcoma. |
| PharmGKB | PA25058. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG317887. |
| HOGENOM | HOG000231241. |
| HOVERGEN | HBG066860. |
| KO | K15627. |
| OMA | PNGRRHT. |
| OrthoDB | EOG49W2FN. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| Bgee | Q9BZE9. |
| CleanEx | HS_ASPSCR1. |
| Genevestigator | Q9BZE9. |
Family and domain databases | |
| InterPro | IPR021569. TUG. IPR001012. UBX. [Graphical view] |
| Pfam | PF11470. TUG. 1 hit. PF00789. UBX. 1 hit. [Graphical view] |
| SMART | SM00166. UBX. 1 hit. [Graphical view] |
| PROSITE | PS50033. UBX. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ASPSCR1. human. |
| GenomeRNAi | 79058. |
| NextBio | 67822. |
| SOURCE | Search... |
Entry information
| Entry name | ASPC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZE9 Secondary accession number(s): A8K3K9 Q96M40 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
