Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ATP-binding cassette sub-family A member 2

Gene

ABCA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable transporter, its natural substrate has not been found yet. May have a role in macrophage lipid metabolism and neural development.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi1024 – 1031ATP 1PROSITE-ProRule annotation8
Nucleotide bindingi2087 – 2094ATP 2PROSITE-ProRule annotation8

GO - Molecular functioni

  • ATPase activity Source: UniProtKB
  • ATPase activity, coupled to transmembrane movement of substances Source: UniProtKB
  • ATP binding Source: UniProtKB
  • nucleotide binding Source: UniProtKB

GO - Biological processi

  • cholesterol efflux Source: GO_Central
  • cholesterol homeostasis Source: UniProtKB
  • lipid metabolic process Source: UniProtKB
  • phospholipid efflux Source: GO_Central
  • regulation of intracellular cholesterol transport Source: UniProtKB
  • regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • response to drug Source: UniProtKB
  • response to steroid hormone Source: UniProtKB
  • transport Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000107331-MONOMER.
ReactomeiR-HSA-1369062. ABC transporters in lipid homeostasis.

Protein family/group databases

TCDBi3.A.1.211.3. the atp-binding cassette (abc) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
ATP-binding cassette sub-family A member 2
Alternative name(s):
ATP-binding cassette transporter 2
Short name:
ATP-binding cassette 2
Gene namesi
Name:ABCA2
Synonyms:ABC2, KIAA1062
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:32. ABCA2.

Subcellular locationi

  • Endosome membrane 1 Publication; Multi-pass membrane protein 1 Publication
  • Lysosome membrane 1 Publication; Multi-pass membrane protein 1 Publication

  • Note: Forms discrete, punctate intracellular vesicles.

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei22 – 42HelicalSequence analysisAdd BLAST21
Transmembranei54 – 74HelicalSequence analysisAdd BLAST21
Transmembranei699 – 719HelicalSequence analysisAdd BLAST21
Transmembranei750 – 770HelicalSequence analysisAdd BLAST21
Transmembranei782 – 802HelicalSequence analysisAdd BLAST21
Transmembranei813 – 833HelicalSequence analysisAdd BLAST21
Transmembranei857 – 877HelicalSequence analysisAdd BLAST21
Transmembranei893 – 913HelicalSequence analysisAdd BLAST21
Transmembranei1456 – 1476HelicalSequence analysisAdd BLAST21
Transmembranei1792 – 1812HelicalSequence analysisAdd BLAST21
Transmembranei1841 – 1861HelicalSequence analysisAdd BLAST21
Transmembranei1872 – 1892HelicalSequence analysisAdd BLAST21
Transmembranei1905 – 1925HelicalSequence analysisAdd BLAST21
Transmembranei1991 – 2011HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • ATP-binding cassette (ABC) transporter complex Source: UniProtKB
  • cytoplasmic, membrane-bounded vesicle Source: UniProtKB
  • endosome Source: UniProtKB
  • endosome membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB
  • lysosomal membrane Source: UniProtKB
  • lysosome Source: UniProtKB
  • membrane Source: UniProtKB
  • microtubule organizing center Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Lysosome, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi20.
PharmGKBiPA24377.

Polymorphism and mutation databases

BioMutaiABCA2.
DMDMi206729923.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000932901 – 2435ATP-binding cassette sub-family A member 2Add BLAST2435

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi14N-linked (GlcNAc...)Sequence analysis1
Glycosylationi89N-linked (GlcNAc...)Sequence analysis1
Glycosylationi168N-linked (GlcNAc...)Sequence analysis1
Glycosylationi173N-linked (GlcNAc...)Sequence analysis1
Glycosylationi305N-linked (GlcNAc...)Sequence analysis1
Glycosylationi368N-linked (GlcNAc...)Sequence analysis1
Glycosylationi379N-linked (GlcNAc...)Sequence analysis1
Glycosylationi420N-linked (GlcNAc...)Sequence analysis1
Glycosylationi432N-linked (GlcNAc...)Sequence analysis1
Glycosylationi476N-linked (GlcNAc...)Sequence analysis1
Glycosylationi484N-linked (GlcNAc...)Sequence analysis1
Glycosylationi494N-linked (GlcNAc...)Sequence analysis1
Glycosylationi530N-linked (GlcNAc...)Sequence analysis1
Glycosylationi544N-linked (GlcNAc...)Sequence analysis1
Glycosylationi590N-linked (GlcNAc...)Sequence analysis1
Glycosylationi600N-linked (GlcNAc...)Sequence analysis1
Glycosylationi628N-linked (GlcNAc...)Sequence analysis1
Modified residuei1238PhosphoserineCombined sources1
Modified residuei1327PhosphoserineCombined sources1
Modified residuei1331PhosphoserineCombined sources1
Glycosylationi1408N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1496N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1549N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1557N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1612N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1677N-linked (GlcNAc...)Sequence analysis1
Glycosylationi1775N-linked (GlcNAc...)Sequence analysis1
Glycosylationi2054N-linked (GlcNAc...)Sequence analysis1
Modified residuei2412PhosphothreonineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9BZC7.
MaxQBiQ9BZC7.
PaxDbiQ9BZC7.
PeptideAtlasiQ9BZC7.
PRIDEiQ9BZC7.

PTM databases

iPTMnetiQ9BZC7.
PhosphoSitePlusiQ9BZC7.

Expressioni

Tissue specificityi

Highly expressed in the brain, whereas lower levels of expression is observed in kidney and liver.1 Publication

Gene expression databases

BgeeiENSG00000107331.
CleanExiHS_ABCA2.
ExpressionAtlasiQ9BZC7. baseline and differential.
GenevisibleiQ9BZC7. HS.

Organism-specific databases

HPAiHPA042886.

Interactioni

Protein-protein interaction databases

BioGridi106538. 21 interactors.
IntActiQ9BZC7. 16 interactors.
STRINGi9606.ENSP00000344155.

Structurei

3D structure databases

ProteinModelPortaliQ9BZC7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini990 – 1221ABC transporter 1PROSITE-ProRule annotationAdd BLAST232
Domaini2050 – 2285ABC transporter 2PROSITE-ProRule annotationAdd BLAST236

Sequence similaritiesi

Contains 2 ABC transporter domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0059. Eukaryota.
COG1131. LUCA.
HOGENOMiHOG000231547.
HOVERGENiHBG050436.
InParanoidiQ9BZC7.
KOiK05642.
PhylomeDBiQ9BZC7.
TreeFamiTF105191.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR026082. ABC_A.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR030366. ABCA2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR19229. PTHR19229. 5 hits.
PTHR19229:SF116. PTHR19229:SF116. 5 hits.
PfamiPF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
PROSITEiPS00211. ABC_TRANSPORTER_1. 1 hit.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BZC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGFLHQLQLL LWKNVTLKRR SPWVLAFEIF IPLVLFFILL GLRQKKPTIS
60 70 80 90 100
VKEAFYTAAP LTSAGILPVM QSLCPDGQRD EFGFLQYANS TVTQLLERLD
110 120 130 140 150
RVVEEGNLFD PARPSLGSEL EALRQHLEAL SAGPGTSGSH LDRSTVSSFS
160 170 180 190 200
LDSVARNPQE LWRFLTQNLS LPNSTAQALL AARVDPPEVY HLLFGPSSAL
210 220 230 240 250
DSQSGLHKGQ EPWSRLGGNP LFRMEELLLA PALLEQLTCT PGSGELGRIL
260 270 280 290 300
TVPESQKGAL QGYRDAVCSG QAAARARRFS GLSAELRNQL DVAKVSQQLG
310 320 330 340 350
LDAPNGSDSS PQAPPPRRLQ ALLGDLLDAQ KVLQDVDVLS ALALLLPQGA
360 370 380 390 400
CTGRTPGPPA SGAGGAANGT GAGAVMGPNA TAEEGAPSAA ALATPDTLQG
410 420 430 440 450
QCSAFVQLWA GLQPILCGNN RTIEPEALRR GNMSSLGFTS KEQRNLGLLV
460 470 480 490 500
HLMTSNPKIL YAPAGSEVDR VILKANETFA FVGNVTHYAQ VWLNISAEIR
510 520 530 540 550
SFLEQGRLQQ HLRWLQQYVA ELRLHPEALN LSLDELPPAL RQDNFSLPSG
560 570 580 590 600
MALLQQLDTI DNAACGWIQF MSKVSVDIFK GFHDEESIVN YTLNQAYQDN
610 620 630 640 650
VTVFASVIFQ TRKDGSLPPH VHYKIRQNSS FTEKTNEIRR AYWRPGPNTG
660 670 680 690 700
GRFYFLYGFV WIQDMMERAI IDTFVGHDVV EPGSYVQMFP YPCYTRDDFL
710 720 730 740 750
FVIEHMMPLC MVISWVYSVA MTIQHIVAEK EHRLKEVMKT MGLNNAVHWV
760 770 780 790 800
AWFITGFVQL SISVTALTAI LKYGQVLMHS HVVIIWLFLA VYAVATIMFC
810 820 830 840 850
FLVSVLYSKA KLASACGGII YFLSYVPYMY VAIREEVAHD KITAFEKCIA
860 870 880 890 900
SLMSTTAFGL GSKYFALYEV AGVGIQWHTF SQSPVEGDDF NLLLAVTMLM
910 920 930 940 950
VDAVVYGILT WYIEAVHPGM YGLPRPWYFP LQKSYWLGSG RTEAWEWSWP
960 970 980 990 1000
WARTPRLSVM EEDQACAMES RRFEETRGME EEPTHLPLVV CVDKLTKVYK
1010 1020 1030 1040 1050
DDKKLALNKL SLNLYENQVV SFLGHNGAGK TTTMSILTGL FPPTSGSATI
1060 1070 1080 1090 1100
YGHDIRTEMD EIRKNLGMCP QHNVLFDRLT VEEHLWFYSR LKSMAQEEIR
1110 1120 1130 1140 1150
REMDKMIEDL ELSNKRHSLV QTLSGGMKRK LSVAIAFVGG SRAIILDEPT
1160 1170 1180 1190 1200
AGVDPYARRA IWDLILKYKP GRTILLSTHH MDEADLLGDR IAIISHGKLK
1210 1220 1230 1240 1250
CCGSPLFLKG TYGDGYRLTL VKRPAEPGGP QEPGLASSPP GRAPLSSCSE
1260 1270 1280 1290 1300
LQVSQFIRKH VASCLLVSDT STELSYILPS EAAKKGAFER LFQHLERSLD
1310 1320 1330 1340 1350
ALHLSSFGLM DTTLEEVFLK VSEEDQSLEN SEADVKESRK DVLPGAEGPA
1360 1370 1380 1390 1400
SGEGHAGNLA RCSELTQSQA SLQSASSVGS ARGDEGAGYT DVYGDYRPLF
1410 1420 1430 1440 1450
DNPQDPDNVS LQEVEAEALS RVGQGSRKLD GGWLKVRQFH GLLVKRFHCA
1460 1470 1480 1490 1500
RRNSKALFSQ ILLPAFFVCV AMTVALSVPE IGDLPPLVLS PSQYHNYTQP
1510 1520 1530 1540 1550
RGNFIPYANE ERREYRLRLS PDASPQQLVS TFRLPSGVGA TCVLKSPANG
1560 1570 1580 1590 1600
SLGPTLNLSS GESRLLAARF FDSMCLESFT QGLPLSNFVP PPPSPAPSDS
1610 1620 1630 1640 1650
PASPDEDLQA WNVSLPPTAG PEMWTSAPSL PRLVREPVRC TCSAQGTGFS
1660 1670 1680 1690 1700
CPSSVGGHPP QMRVVTGDIL TDITGHNVSE YLLFTSDRFR LHRYGAITFG
1710 1720 1730 1740 1750
NVLKSIPASF GTRAPPMVRK IAVRRAAQVF YNNKGYHSMP TYLNSLNNAI
1760 1770 1780 1790 1800
LRANLPKSKG NPAAYGITVT NHPMNKTSAS LSLDYLLQGT DVVIAIFIIV
1810 1820 1830 1840 1850
AMSFVPASFV VFLVAEKSTK AKHLQFVSGC NPIIYWLANY VWDMLNYLVP
1860 1870 1880 1890 1900
ATCCVIILFV FDLPAYTSPT NFPAVLSLFL LYGWSITPIM YPASFWFEVP
1910 1920 1930 1940 1950
SSAYVFLIVI NLFIGITATV ATFLLQLFEH DKDLKVVNSY LKSCFLIFPN
1960 1970 1980 1990 2000
YNLGHGLMEM AYNEYINEYY AKIGQFDKMK SPFEWDIVTR GLVAMAVEGV
2010 2020 2030 2040 2050
VGFLLTIMCQ YNFLRRPQRM PVSTKPVEDD VDVASERQRV LRGDADNDMV
2060 2070 2080 2090 2100
KIENLTKVYK SRKIGRILAV DRLCLGVRPG ECFGLLGVNG AGKTSTFKML
2110 2120 2130 2140 2150
TGDESTTGGE AFVNGHSVLK ELLQVQQSLG YCPQCDALFD ELTAREHLQL
2160 2170 2180 2190 2200
YTRLRGISWK DEARVVKWAL EKLELTKYAD KPAGTYSGGN KRKLSTAIAL
2210 2220 2230 2240 2250
IGYPAFIFLD EPTTGMDPKA RRFLWNLILD LIKTGRSVVL TSHSMEECEA
2260 2270 2280 2290 2300
LCTRLAIMVN GRLRCLGSIQ HLKNRFGDGY MITVRTKSSQ SVKDVVRFFN
2310 2320 2330 2340 2350
RNFPEAMLKE RHHTKVQYQL KSEHISLAQV FSKMEQVSGV LGIEDYSVSQ
2360 2370 2380 2390 2400
TTLDNVFVNF AKKQSDNLEQ QETEPPSALQ SPLGCLLSLL RPRSAPTELR
2410 2420 2430
ALVADEPEDL DTEDEGLISF EEERAQLSFN TDTLC
Length:2,435
Mass (Da):269,873
Last modified:September 23, 2008 - v3
Checksum:i0C4ABE9087BEC5C4
GO
Isoform 2 (identifier: Q9BZC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2059-2090: YKSRKIGRILAVDRLCLGVRPGECFGLLGVNG → GSGHVGWGLGGVGQGQGGGAPAVEVEPGWAGP
     2091-2435: Missing.

Note: No experimental confirmation available.
Show »
Length:2,090
Mass (Da):230,564
Checksum:i0E8343980AF61548
GO
Isoform 3 (identifier: Q9BZC7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-54: EA → EVS

Show »
Length:2,436
Mass (Da):269,988
Checksum:iAF887122E85CA013
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2079P → L in AAK14335 (PubMed:11178988).Curated1
Isoform 3 (identifier: Q9BZC7-3)
Sequence conflicti55S → P in AAK14334 (PubMed:11178988).Curated1
Sequence conflicti55S → P in AAK14335 (PubMed:11178988).Curated1
Sequence conflicti55S → P in AAG09372 (PubMed:11309290).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_044526583H → P.2 PublicationsCorresponds to variant rs908828dbSNPEnsembl.1
Natural variantiVAR_044527674F → V.Corresponds to variant rs2090625dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04093753 – 54EA → EVS in isoform 3. 2 Publications2
Alternative sequenceiVSP_0352832059 – 2090YKSRK…LGVNG → GSGHVGWGLGGVGQGQGGGA PAVEVEPGWAGP in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0352842091 – 2435Missing in isoform 2. 1 PublicationAdd BLAST345

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF327657 mRNA. Translation: AAK14334.1.
AF327705
, AF327658, AF327659, AF327660, AF327661, AF327662, AF327663, AF327664, AF327665, AF327666, AF327667, AF327668, AF327669, AF327670, AF327671, AF327672, AF327673, AF327674, AF327675, AF327676, AF327677, AF327678, AF327679, AF327680, AF327681, AF327682, AF327683, AF327684, AF327685, AF327686, AF327687, AF327688, AF327689, AF327690, AF327691, AF327692, AF327693, AF327694, AF327695, AF327696, AF327697, AF327698, AF327699, AF327700, AF327701, AF327702, AF327703, AF327704 Genomic DNA. Translation: AAK14335.1.
AF178941 mRNA. Translation: AAG09372.1.
AL807752 Genomic DNA. Translation: CAI12768.1.
AB028985 mRNA. Translation: BAA83014.2.
AB177854 mRNA. Translation: BAD66832.1.
CCDSiCCDS43909.1. [Q9BZC7-3]
PIRiA59189.
RefSeqiNP_001597.2. NM_001606.4.
NP_997698.1. NM_212533.2.
UniGeneiHs.421202.

Genome annotation databases

EnsembliENST00000341511; ENSP00000344155; ENSG00000107331.
ENST00000371605; ENSP00000360666; ENSG00000107331.
GeneIDi20.
KEGGihsa:20.
UCSCiuc011mem.1. human. [Q9BZC7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

ABCMdb

Database for mutations in ABC proteins

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF327657 mRNA. Translation: AAK14334.1.
AF327705
, AF327658, AF327659, AF327660, AF327661, AF327662, AF327663, AF327664, AF327665, AF327666, AF327667, AF327668, AF327669, AF327670, AF327671, AF327672, AF327673, AF327674, AF327675, AF327676, AF327677, AF327678, AF327679, AF327680, AF327681, AF327682, AF327683, AF327684, AF327685, AF327686, AF327687, AF327688, AF327689, AF327690, AF327691, AF327692, AF327693, AF327694, AF327695, AF327696, AF327697, AF327698, AF327699, AF327700, AF327701, AF327702, AF327703, AF327704 Genomic DNA. Translation: AAK14335.1.
AF178941 mRNA. Translation: AAG09372.1.
AL807752 Genomic DNA. Translation: CAI12768.1.
AB028985 mRNA. Translation: BAA83014.2.
AB177854 mRNA. Translation: BAD66832.1.
CCDSiCCDS43909.1. [Q9BZC7-3]
PIRiA59189.
RefSeqiNP_001597.2. NM_001606.4.
NP_997698.1. NM_212533.2.
UniGeneiHs.421202.

3D structure databases

ProteinModelPortaliQ9BZC7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106538. 21 interactors.
IntActiQ9BZC7. 16 interactors.
STRINGi9606.ENSP00000344155.

Protein family/group databases

TCDBi3.A.1.211.3. the atp-binding cassette (abc) superfamily.

PTM databases

iPTMnetiQ9BZC7.
PhosphoSitePlusiQ9BZC7.

Polymorphism and mutation databases

BioMutaiABCA2.
DMDMi206729923.

Proteomic databases

EPDiQ9BZC7.
MaxQBiQ9BZC7.
PaxDbiQ9BZC7.
PeptideAtlasiQ9BZC7.
PRIDEiQ9BZC7.

Protocols and materials databases

DNASUi20.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341511; ENSP00000344155; ENSG00000107331.
ENST00000371605; ENSP00000360666; ENSG00000107331.
GeneIDi20.
KEGGihsa:20.
UCSCiuc011mem.1. human. [Q9BZC7-1]

Organism-specific databases

CTDi20.
DisGeNETi20.
GeneCardsiABCA2.
HGNCiHGNC:32. ABCA2.
HPAiHPA042886.
MIMi600047. gene.
neXtProtiNX_Q9BZC7.
PharmGKBiPA24377.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0059. Eukaryota.
COG1131. LUCA.
HOGENOMiHOG000231547.
HOVERGENiHBG050436.
InParanoidiQ9BZC7.
KOiK05642.
PhylomeDBiQ9BZC7.
TreeFamiTF105191.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000107331-MONOMER.
ReactomeiR-HSA-1369062. ABC transporters in lipid homeostasis.

Miscellaneous databases

ChiTaRSiABCA2. human.
GeneWikiiABCA2.
GenomeRNAii20.
PROiQ9BZC7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000107331.
CleanExiHS_ABCA2.
ExpressionAtlasiQ9BZC7. baseline and differential.
GenevisibleiQ9BZC7. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR003593. AAA+_ATPase.
IPR026082. ABC_A.
IPR003439. ABC_transporter-like.
IPR017871. ABC_transporter_CS.
IPR030366. ABCA2.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR19229. PTHR19229. 5 hits.
PTHR19229:SF116. PTHR19229:SF116. 5 hits.
PfamiPF00005. ABC_tran. 2 hits.
[Graphical view]
SMARTiSM00382. AAA. 2 hits.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 2 hits.
PROSITEiPS00211. ABC_TRANSPORTER_1. 1 hit.
PS50893. ABC_TRANSPORTER_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiABCA2_HUMAN
AccessioniPrimary (citable) accession number: Q9BZC7
Secondary accession number(s): A6NED5
, Q5SPY5, Q5W9G5, Q76MW7, Q9HC28
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2001
Last sequence update: September 23, 2008
Last modified: November 2, 2016
This is version 136 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.