Q9BZC7 (ABCA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ATP-binding cassette sub-family A member 2 Alternative name(s): ATP-binding cassette transporter 2 Short name=ATP-binding cassette 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2435 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable transporter, its natural substrate has not been found yet. May have a role in macrophage lipid metabolism and neural development. |
| Subcellular location | Endosome. Membrane; Multi-pass membrane protein. Lysosome. Membrane; Multi-pass membrane protein. Note: Forms discrete, punctate intracellular vesicles. Ref.2 |
| Tissue specificity | Highy expressed in the brain, whereas lower levels of expression is observed in kidney and liver. Ref.2 |
| Sequence similarities | Belongs to the ABC transporter superfamily. ABCA family. Contains 2 ABC transporter domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: Q9BZC7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q9BZC7-2) The sequence of this isoform differs from the canonical sequence as follows: 2059-2090: YKSRKIGRILAVDRLCLGVRPGECFGLLGVNG → GSGHVGWGLGGVGQGQGGGAPAVEVEPGWAGP 2091-2435: Missing. | |||||||||
| Note: No experimental confirmation available. | |||||||||
| Isoform 3 (identifier: Q9BZC7-3) The sequence of this isoform differs from the canonical sequence as follows: 53-54: EA → EVS | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 55 | 1 | S → P in AAK14334. Ref.1 | ||||||
| Sequence conflict | 55 | 1 | S → P in AAK14335. Ref.1 | ||||||
| Sequence conflict | 55 | 1 | S → P in AAG09372. Ref.2 | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2435 | 2435 | ATP-binding cassette sub-family A member 2 | PRO_0000093290 | |||||
Regions | |||||||||
| Transmembrane | 22 – 42 | 21 | Helical; Potential | ||||||
| Transmembrane | 54 – 74 | 21 | Helical; Potential | ||||||
| Transmembrane | 699 – 719 | 21 | Helical; Potential | ||||||
| Transmembrane | 750 – 770 | 21 | Helical; Potential | ||||||
| Transmembrane | 782 – 802 | 21 | Helical; Potential | ||||||
| Transmembrane | 813 – 833 | 21 | Helical; Potential | ||||||
| Transmembrane | 857 – 877 | 21 | Helical; Potential | ||||||
| Transmembrane | 893 – 913 | 21 | Helical; Potential | ||||||
| Transmembrane | 1456 – 1476 | 21 | Helical; Potential | ||||||
| Transmembrane | 1792 – 1812 | 21 | Helical; Potential | ||||||
| Transmembrane | 1841 – 1861 | 21 | Helical; Potential | ||||||
| Transmembrane | 1872 – 1892 | 21 | Helical; Potential | ||||||
| Transmembrane | 1905 – 1925 | 21 | Helical; Potential | ||||||
| Transmembrane | 1991 – 2011 | 21 | Helical; Potential | ||||||
| Domain | 990 – 1221 | 232 | ABC transporter 1 | ||||||
| Domain | 2050 – 2285 | 236 | ABC transporter 2 | ||||||
| Nucleotide binding | 1024 – 1031 | 8 | ATP 1 Potential | ||||||
| Nucleotide binding | 2087 – 2094 | 8 | ATP 2 Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1327 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1331 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 2412 | 1 | Phosphothreonine Ref.7 | ||||||
| Glycosylation | 14 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 89 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 168 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 305 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 379 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 420 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 432 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 476 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 484 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 494 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 530 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 544 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 590 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 600 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 628 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1408 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1496 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1549 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1557 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1612 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1677 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1775 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 2054 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 53 – 54 | 2 | EA → EVS in isoform 3. | VSP_040937 | |||||
| Alternative sequence | 2059 – 2090 | 32 | YKSRK…LGVNG → GSGHVGWGLGGVGQGQGGGA PAVEVEPGWAGP in isoform 2. | VSP_035283 | |||||
| Alternative sequence | 2091 – 2435 | 345 | Missing in isoform 2. | VSP_035284 | |||||
| Natural variant | 583 | 1 | H → P. Ref.1 Ref.2 Corresponds to variant rs908828 [ dbSNP | Ensembl ]. | VAR_044526 | |||||
| Natural variant | 674 | 1 | F → V. Corresponds to variant rs2090625 [ dbSNP | Ensembl ]. | VAR_044527 | |||||
Experimental info | |||||||||
| Sequence conflict | 2079 | 1 | P → L in AAK14335. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete coding sequence, promoter region, and genomic structure of the human ABCA2 gene and evidence for sterol-dependent regulation in macrophages." Kaminski W.E., Piehler A., Pullmann K., Porsch-Oezcueruemez M., Duong C., Bared G.M., Buchler C., Schmitz G. Biochem. Biophys. Res. Commun. 281:249-258(2001) [PubMed: 11178988] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 3), VARIANT PRO-583. |
| [2] | "Cloning and characterization of human adenosine 5'-triphosphate-binding cassette, sub-family A, transporter 2." Vulevic B., Chen Z., Boyd J.T., Davis W. Jr., Walsh E.S., Belinsky M.G., Tew K.D. Cancer Res. 61:3339-3347(2001) [PubMed: 11309290] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANT PRO-583. Tissue: Brain. |
| [3] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed: 10470851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 651-2435 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 665-2435 (ISOFORM 1). Tissue: Brain. |
| [5] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1327 AND SER-1331, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2412, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF327657 mRNA. Translation: AAK14334.1. AF327705 AF327704 Genomic DNA. Translation: AAK14335.1.AF178941 mRNA. Translation: AAG09372.1. AL807752 Genomic DNA. Translation: CAI12768.1. AB028985 mRNA. Translation: BAA83014.2. AB177854 mRNA. Translation: BAD66832.1. |
| IPI | IPI00307592. IPI00937612. IPI01009012. |
| PIR | A59189. |
| RefSeq | NP_001597.2. NM_001606.4. NP_997698.1. NM_212533.2. |
| UniGene | Hs.421202. |
3D structure databases | |
| ProteinModelPortal | Q9BZC7. |
| SMR | Q9BZC7. Positions 990-1214, 2049-2280. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BZC7. 2 interactions. |
| STRING | Q9BZC7. |
Protein family/group databases | |
| TCDB | 3.A.1.211.3. ATP-binding cassette (ABC) superfamily. |
PTM databases | |
| PhosphoSite | Q9BZC7. |
Polymorphism databases | |
| DMDM | 206729923. |
Proteomic databases | |
| PRIDE | Q9BZC7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265662; ENSP00000265662; ENSG00000107331. ENST00000341511; ENSP00000344155; ENSG00000107331. ENST00000371605; ENSP00000360666; ENSG00000107331. |
| GeneID | 20. |
| KEGG | hsa:20. |
Organism-specific databases | |
| CTD | 20. |
| GeneCards | GC09M139901. |
| H-InvDB | HIX0021739. |
| HGNC | HGNC:32. ABCA2. |
| MIM | 600047. gene. |
| neXtProt | NX_Q9BZC7. |
| PharmGKB | PA24377. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07779. |
| HOVERGEN | HBG050436. |
| PhylomeDB | Q9BZC7. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9BZC7. |
| Bgee | Q9BZC7. |
| CleanEx | HS_ABCA2. |
| Genevestigator | Q9BZC7. |
| GermOnline | ENSG00000107331. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003439. ABC_transporter-like. IPR017871. ABC_transporter_CS. IPR003593. ATPase_AAA+_core. [Graphical view] |
| KO | K05642. |
| Pfam | PF00005. ABC_tran. 2 hits. [Graphical view] |
| SMART | SM00382. AAA. 2 hits. [Graphical view] |
| PROSITE | PS00211. ABC_TRANSPORTER_1. 1 hit. PS50893. ABC_TRANSPORTER_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 55. |
| SOURCE | Search... |
Entry information
| Entry name | ABCA2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZC7 Secondary accession number(s): A6NED5 Q9HC28 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with