Q9BZ72 (PITM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Membrane-associated phosphatidylinositol transfer protein 2 Alternative name(s): Phosphatidylinositol transfer protein, membrane-associated 2 Short name=PITPnm 2 Pyk2 N-terminal domain-interacting receptor 3 Short name=NIR-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1349 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro). Binds calcium ions. Ref.1 |
| Subunit structure | Interacts with PTK2B via its C-terminus. Ref.1 |
| Subcellular location | |
| Tissue specificity | Highly expressed in brain, heart, ovary, testis and thymus. Detected in small intestine, prostate, pancreas, skeletal muscle, liver, colon and placenta. Ref.1 |
| Sequence similarities | Belongs to the PtdIns transfer protein family. PI transfer class IIA subfamily. Contains 1 DDHD domain. |
| Sequence caution | The sequence BAA95981.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Calcium Lipid-binding Metal-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | metabolic process Non-traceable author statement Ref.1. Source: UniProtKB transportInferred from electronic annotation. Source: InterPro |
| Cellular_component | endomembrane system Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneNon-traceable author statement Ref.1. Source: UniProtKB intracellular membrane-bounded organelleInferred from direct assay. Source: HPA |
| Molecular_function | calcium ion binding Non-traceable author statement Ref.1. Source: UniProtKB lipid bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BZ72-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BZ72-2) The sequence of this isoform differs from the canonical sequence as follows: 802-802: A → VETVQRNPELVLEGGPLAPLPHGDGFLETSMPVPAPTWQDGPRPGCAES 857-911: KAPDALSHTPSVRRLSLLALPAPSPTTPGPHPPARKASPGLERAPGLPELDIGEV → I | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9BZ72-3) The sequence of this isoform differs from the canonical sequence as follows: 50-328: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1349 | 1349 | Membrane-associated phosphatidylinositol transfer protein 2 | PRO_0000232741 | |||||
Regions | |||||||||
| Domain | 715 – 963 | 249 | DDHD | ||||||
| Compositional bias | 612 – 632 | 21 | Gly-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1277 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 50 – 328 | 279 | Missing in isoform 3. | VSP_017961 | |||||
| Alternative sequence | 802 | 1 | A → VETVQRNPELVLEGGPLAPL PHGDGFLETSMPVPAPTWQD GPRPGCAES in isoform 2. | VSP_017962 | |||||
| Alternative sequence | 857 – 911 | 55 | KAPDA…DIGEV → I in isoform 2. | VSP_017963 | |||||
| Natural variant | 9 | 1 | P → L. Corresponds to variant rs17884869 [ dbSNP | Ensembl ]. | VAR_053584 | |||||
| Natural variant | 661 | 1 | L → M. Corresponds to variant rs55813219 [ dbSNP | Ensembl ]. | VAR_062131 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel family of targets of PYK2 related to Drosophila retinal degeneration B (rdgB) protein." Lev S., Hernandez J., Martinez R., Chen A., Plowman G., Schlessinger J. Mol. Cell. Biol. 19:2278-2288(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, ALTERNATIVE SPLICING (ISOFORMS 1 AND 3), INTERACTION WITH PTK2B, CALCIUM-BINDING, TISSUE SPECIFICITY. Tissue: Brain and Heart. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy." Stadler C., Hjelmare M., Neumann B., Jonasson K., Pepperkok R., Uhlen M., Lundberg E. J. Proteomics 75:2236-2251(2012) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF334585 mRNA. Translation: AAK01445.1. AB040890 mRNA. Translation: BAA95981.2. Different initiation. |
| IPI | IPI00097494. IPI00155134. IPI00747418. |
| RefSeq | NP_065896.1. NM_020845.2. |
| UniGene | Hs.272759. |
3D structure databases | |
| ProteinModelPortal | Q9BZ72. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BZ72. 1 interaction. |
| STRING | 9606.ENSP00000322218. |
PTM databases | |
| PhosphoSite | Q9BZ72. |
Polymorphism databases | |
| DMDM | 74717733. |
Proteomic databases | |
| PaxDb | Q9BZ72. |
| PRIDE | Q9BZ72. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000280562; ENSP00000280562; ENSG00000090975. ENST00000320201; ENSP00000322218; ENSG00000090975. ENST00000542749; ENSP00000437611; ENSG00000090975. |
| GeneID | 57605. |
| KEGG | hsa:57605. |
| UCSC | uc001uej.1. human. uc001uek.1. human. |
Organism-specific databases | |
| CTD | 57605. |
| GeneCards | GC12M123468. |
| H-InvDB | HIX0011103. |
| HGNC | HGNC:21044. PITPNM2. |
| HPA | HPA003414. HPA003978. |
| MIM | 608920. gene. |
| neXtProt | NX_Q9BZ72. |
| PharmGKB | PA134963002. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5083. |
| HOGENOM | HOG000294231. |
| HOVERGEN | HBG052733. |
| InParanoid | Q9BZ72. |
| OMA | NTVFQEH. |
| OrthoDB | EOG479F68. |
Gene expression databases | |
| ArrayExpress | Q9BZ72. |
| Bgee | Q9BZ72. |
| CleanEx | HS_PITPNM2. |
| Genevestigator | Q9BZ72. |
| GermOnline | ENSG00000090975. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.530.20. 1 hit. 3.40.50.1000. 1 hit. |
| InterPro | IPR004177. DDHD. IPR023214. HAD-like_dom. IPR013209. LNS2. IPR001666. PI_transfer. IPR023393. START-like_dom. [Graphical view] |
| PANTHER | PTHR10658. PTHR10658. 1 hit. |
| Pfam | PF02862. DDHD. 1 hit. PF02121. IP_trans. 1 hit. PF08235. LNS2. 1 hit. [Graphical view] |
| PRINTS | PR00391. PITRANSFER. |
| SMART | SM00775. LNS2. 1 hit. [Graphical view] |
| SUPFAM | SSF56784. HAD-like_dom. 1 hit. |
| PROSITE | PS51043. DDHD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | PITPNM2. human. |
| GenomeRNAi | 57605. |
| NextBio | 64231. |
| SOURCE | Search... |
Entry information
| Entry name | PITM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BZ72 Secondary accession number(s): Q9P271 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
