Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BYV6

- TRI55_HUMAN

UniProt

Q9BYV6 - TRI55_HUMAN

Protein

Tripartite motif-containing protein 55

Gene

TRIM55

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (25 Oct 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May regulate gene expression and protein turnover in muscle cells.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri10 – 6657RING-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri103 – 14543B box-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. identical protein binding Source: IntAct
    2. signal transducer activity Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. signal transduction Source: UniProtKB

    Keywords - Molecular functioni

    Muscle protein

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tripartite motif-containing protein 55
    Alternative name(s):
    Muscle-specific RING finger protein 2
    Short name:
    MuRF-2
    Short name:
    MuRF2
    RING finger protein 29
    Gene namesi
    Name:TRIM55
    Synonyms:MURF2, RNF29
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:14215. TRIM55.

    Subcellular locationi

    Cytoplasm By similarity. Nucleus By similarity
    Note: Nuclear under atrophic conditions and upon mechanical signals. Localizes to the sarcomeric M-band in cardiomyocytes. Colocalizes in part with microtubules By similarity.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. microtubule Source: UniProtKB
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34432.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 548548Tripartite motif-containing protein 55PRO_0000056286Add
    BLAST

    Proteomic databases

    MaxQBiQ9BYV6.
    PaxDbiQ9BYV6.
    PRIDEiQ9BYV6.

    PTM databases

    PhosphoSiteiQ9BYV6.

    Expressioni

    Tissue specificityi

    Highly expressed in muscle. Low-level expression in liver.1 Publication

    Gene expression databases

    BgeeiQ9BYV6.
    CleanExiHS_TRIM55.
    GenevestigatoriQ9BYV6.

    Organism-specific databases

    HPAiHPA038793.
    HPA053691.

    Interactioni

    Subunit structurei

    Homooligomer and heterooligomer Probable. Interacts with titin/TTN. Interacts with myosins. Interacts with SQSTM1 and NBR1. Isoform 4 may not able to interact with isoform 1, isoform 2 and isoform 3. Probably interacts with TRIM63 and TRIM54.3 PublicationsCurated

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    itself2EBI-2341179,EBI-2341179

    Protein-protein interaction databases

    BioGridi124194. 54 interactions.
    IntActiQ9BYV6. 14 interactions.
    MINTiMINT-4723378.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BYV6.
    SMRiQ9BYV6. Positions 15-81, 123-166, 216-272.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini269 – 32759COSPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili168 – 24881Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 B box-type zinc finger.PROSITE-ProRule annotation
    Contains 1 COS domain.PROSITE-ProRule annotation
    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri10 – 6657RING-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri103 – 14543B box-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG310224.
    HOVERGENiHBG071242.
    InParanoidiQ9BYV6.
    KOiK10654.
    OMAiEIDFYRE.
    OrthoDBiEOG7VDXPK.
    PhylomeDBiQ9BYV6.
    TreeFamiTF331669.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    4.10.45.10. 1 hit.
    InterProiIPR017903. COS_domain.
    IPR000315. Znf_B-box.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view]
    PfamiPF00643. zf-B_box. 1 hit.
    [Graphical view]
    SMARTiSM00336. BBOX. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view]
    PROSITEiPS51262. COS. 1 hit.
    PS50119. ZF_BBOX. 1 hit.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BYV6-1) [UniParc]FASTAAdd to Basket

    Also known as: p60

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSASLNYKSF SKEQQTMDNL EKQLICPICL EMFTKPVVIL PCQHNLCRKC    50
    ASDIFQASNP YLPTRGGTTM ASGGRFRCPS CRHEVVLDRH GVYGLQRNLL 100
    VENIIDIYKQ ESTRPEKKSD QPMCEEHEEE RINIYCLNCE VPTCSLCKVF 150
    GAHKDCQVAP LTHVFQRQKS ELSDGIAILV GSNDRVQGVI SQLEDTCKTI 200
    EECCRKQKQE LCEKFDYLYG ILEERKNEMT QVITRTQEEK LEHVRALIKK 250
    YSDHLENVSK LVESGIQFMD EPEMAVFLQN AKTLLKKISE ASKAFQMEKI 300
    EHGYENMNHF TVNLNREEKI IREIDFYRED EDEEEEEGGE GEKEGEGEVG 350
    GEAVEVEEVE NVQTEFPGED ENPEKASELS QVELQAAPGA LPVSSPEPPP 400
    ALPPAADAPV TQGEVVPTGS EQTTESETPV PAAAETADPL FYPSWYKGQT 450
    RKATTNPPCT PGSEGLGQIG PPGSEDSNVR KAEVAAAAAS ERAAVSGKET 500
    SAPAATSQIG FEAPPLQGQA AAPASGSGAD SEPARHIFSF SWLNSLNE 548
    Length:548
    Mass (Da):60,466
    Last modified:October 25, 2005 - v2
    Checksum:i2AA2E4D4F5C3E3A1
    GO
    Isoform 2 (identifier: Q9BYV6-2) [UniParc]FASTAAdd to Basket

    Also known as: p50

    The sequence of this isoform differs from the canonical sequence as follows:
         412-507: Missing.

    Show »
    Length:452
    Mass (Da):50,823
    Checksum:i47E656DC77628A45
    GO
    Isoform 3 (identifier: Q9BYV6-3) [UniParc]FASTAAdd to Basket

    Also known as: p60B

    The sequence of this isoform differs from the canonical sequence as follows:
         509-548: IGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE → ELVICLALLAFLILHYIWSQIQCLIFTLMDWI

    Show »
    Length:540
    Mass (Da):60,174
    Checksum:i5F017CFB82982E81
    GO
    Isoform 4 (identifier: Q9BYV6-4) [UniParc]FASTAAdd to Basket

    Also known as: p27

    The sequence of this isoform differs from the canonical sequence as follows:
         202-508: Missing.

    Show »
    Length:241
    Mass (Da):26,841
    Checksum:i21951B79C1B89B37
    GO

    Sequence cautioni

    The sequence AAP35876.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAC32839.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAC32840.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti102 – 1021E → G in CAC43019. (PubMed:12414993)Curated
    Sequence conflicti102 – 1021E → G in CAC43020. (PubMed:12414993)Curated
    Sequence conflicti345 – 3451G → E in CAC43019. (PubMed:12414993)Curated
    Sequence conflicti345 – 3451G → E in CAC43020. (PubMed:12414993)Curated
    Sequence conflicti345 – 3451G → E in CAD24432. (PubMed:12414993)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti343 – 3431K → R.
    Corresponds to variant rs7843605 [ dbSNP | Ensembl ].
    VAR_052144

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei202 – 508307Missing in isoform 4. 1 PublicationVSP_015996Add
    BLAST
    Alternative sequencei412 – 50796Missing in isoform 2. 5 PublicationsVSP_015997Add
    BLAST
    Alternative sequencei509 – 54840IGFEA…NSLNE → ELVICLALLAFLILHYIWSQ IQCLIFTLMDWI in isoform 3. 1 PublicationVSP_015998Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ291712 mRNA. Translation: CAC32839.1. Different initiation.
    AJ291712 mRNA. Translation: CAC32840.1. Different initiation.
    AJ243488 mRNA. Translation: CAC43019.1.
    AJ243489 mRNA. Translation: CAC43020.1.
    AJ277493 mRNA. Translation: CAC81835.1.
    AJ431704 mRNA. Translation: CAD24432.1.
    AK091310 mRNA. Translation: BAG52332.1.
    AK091728 mRNA. Translation: BAG52405.1.
    CH471068 Genomic DNA. Translation: EAW86894.1.
    CH471068 Genomic DNA. Translation: EAW86895.1.
    BC007750 mRNA. Translation: AAH07750.2.
    BT007212 mRNA. Translation: AAP35876.1. Different initiation.
    CCDSiCCDS6184.1. [Q9BYV6-1]
    CCDS6185.1. [Q9BYV6-2]
    CCDS6186.1. [Q9BYV6-4]
    CCDS6187.1. [Q9BYV6-3]
    RefSeqiNP_149047.2. NM_033058.2. [Q9BYV6-3]
    NP_908973.1. NM_184085.1. [Q9BYV6-1]
    NP_908974.1. NM_184086.1. [Q9BYV6-2]
    NP_908975.1. NM_184087.1. [Q9BYV6-4]
    UniGeneiHs.85524.

    Genome annotation databases

    EnsembliENST00000276573; ENSP00000276573; ENSG00000147573. [Q9BYV6-3]
    ENST00000315962; ENSP00000323913; ENSG00000147573. [Q9BYV6-1]
    ENST00000350034; ENSP00000332302; ENSG00000147573. [Q9BYV6-4]
    ENST00000353317; ENSP00000297348; ENSG00000147573. [Q9BYV6-2]
    GeneIDi84675.
    KEGGihsa:84675.
    UCSCiuc003xvu.3. human. [Q9BYV6-3]
    uc003xvv.3. human. [Q9BYV6-1]
    uc003xvw.3. human. [Q9BYV6-2]
    uc003xvx.3. human. [Q9BYV6-4]

    Polymorphism databases

    DMDMi78099806.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ291712 mRNA. Translation: CAC32839.1 . Different initiation.
    AJ291712 mRNA. Translation: CAC32840.1 . Different initiation.
    AJ243488 mRNA. Translation: CAC43019.1 .
    AJ243489 mRNA. Translation: CAC43020.1 .
    AJ277493 mRNA. Translation: CAC81835.1 .
    AJ431704 mRNA. Translation: CAD24432.1 .
    AK091310 mRNA. Translation: BAG52332.1 .
    AK091728 mRNA. Translation: BAG52405.1 .
    CH471068 Genomic DNA. Translation: EAW86894.1 .
    CH471068 Genomic DNA. Translation: EAW86895.1 .
    BC007750 mRNA. Translation: AAH07750.2 .
    BT007212 mRNA. Translation: AAP35876.1 . Different initiation.
    CCDSi CCDS6184.1. [Q9BYV6-1 ]
    CCDS6185.1. [Q9BYV6-2 ]
    CCDS6186.1. [Q9BYV6-4 ]
    CCDS6187.1. [Q9BYV6-3 ]
    RefSeqi NP_149047.2. NM_033058.2. [Q9BYV6-3 ]
    NP_908973.1. NM_184085.1. [Q9BYV6-1 ]
    NP_908974.1. NM_184086.1. [Q9BYV6-2 ]
    NP_908975.1. NM_184087.1. [Q9BYV6-4 ]
    UniGenei Hs.85524.

    3D structure databases

    ProteinModelPortali Q9BYV6.
    SMRi Q9BYV6. Positions 15-81, 123-166, 216-272.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124194. 54 interactions.
    IntActi Q9BYV6. 14 interactions.
    MINTi MINT-4723378.

    PTM databases

    PhosphoSitei Q9BYV6.

    Polymorphism databases

    DMDMi 78099806.

    Proteomic databases

    MaxQBi Q9BYV6.
    PaxDbi Q9BYV6.
    PRIDEi Q9BYV6.

    Protocols and materials databases

    DNASUi 84675.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000276573 ; ENSP00000276573 ; ENSG00000147573 . [Q9BYV6-3 ]
    ENST00000315962 ; ENSP00000323913 ; ENSG00000147573 . [Q9BYV6-1 ]
    ENST00000350034 ; ENSP00000332302 ; ENSG00000147573 . [Q9BYV6-4 ]
    ENST00000353317 ; ENSP00000297348 ; ENSG00000147573 . [Q9BYV6-2 ]
    GeneIDi 84675.
    KEGGi hsa:84675.
    UCSCi uc003xvu.3. human. [Q9BYV6-3 ]
    uc003xvv.3. human. [Q9BYV6-1 ]
    uc003xvw.3. human. [Q9BYV6-2 ]
    uc003xvx.3. human. [Q9BYV6-4 ]

    Organism-specific databases

    CTDi 84675.
    GeneCardsi GC08P067039.
    HGNCi HGNC:14215. TRIM55.
    HPAi HPA038793.
    HPA053691.
    MIMi 606469. gene.
    neXtProti NX_Q9BYV6.
    PharmGKBi PA34432.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310224.
    HOVERGENi HBG071242.
    InParanoidi Q9BYV6.
    KOi K10654.
    OMAi EIDFYRE.
    OrthoDBi EOG7VDXPK.
    PhylomeDBi Q9BYV6.
    TreeFami TF331669.

    Miscellaneous databases

    GeneWikii TRIM55.
    GenomeRNAii 84675.
    NextBioi 74689.
    PROi Q9BYV6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9BYV6.
    CleanExi HS_TRIM55.
    Genevestigatori Q9BYV6.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    4.10.45.10. 1 hit.
    InterProi IPR017903. COS_domain.
    IPR000315. Znf_B-box.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view ]
    Pfami PF00643. zf-B_box. 1 hit.
    [Graphical view ]
    SMARTi SM00336. BBOX. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view ]
    PROSITEi PS51262. COS. 1 hit.
    PS50119. ZF_BBOX. 1 hit.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of muscle specific ring finger proteins as potential regulators of the titin kinase domain."
      Centner T., Yano J., Kimura E., McElhinny A.S., Pelin K., Witt C.C., Bang M.-L., Trombitas K., Granzier H., Gregorio C.C., Sorimachi H., Labeit S.
      J. Mol. Biol. 306:717-726(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, INTERACTION WITH TRIM63 AND TRIM54.
      Tissue: Heart.
    2. "Transient association of titin and myosin with microtubules in nascent myofibrils directed by the MURF2 RING-finger protein."
      Pizon V., Iakovenko A., van der Ven P.F.M., Kelly R., Fatu C., Fuerst D.O., Karsenti E., Gautel M.
      J. Cell Sci. 115:4469-4482(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), OLIGOMERIZATION, INTERACTION WITH TTN AND MYOSIN.
      Tissue: Heart muscle and Skeletal muscle.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Heart.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Muscle.
    6. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-548 (ISOFORM 2).
    7. Cited for: INTERACTION WITH TTN; SQSTM1 AND NBR1.

    Entry informationi

    Entry nameiTRI55_HUMAN
    AccessioniPrimary (citable) accession number: Q9BYV6
    Secondary accession number(s): B3KRC0
    , B3KRJ3, Q53XX3, Q8IUD9, Q8IUE4, Q96DV2, Q96DV3, Q9BYV5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 6, 2002
    Last sequence update: October 25, 2005
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-17 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3