Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tripartite motif-containing protein 55

Gene

TRIM55

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May regulate gene expression and protein turnover in muscle cells.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri10 – 6657RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri103 – 14543B box-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • signal transducer activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Muscle protein

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Tripartite motif-containing protein 55
Alternative name(s):
Muscle-specific RING finger protein 2
Short name:
MuRF-2
Short name:
MuRF2
RING finger protein 29
Gene namesi
Name:TRIM55
Synonyms:MURF2, RNF29
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:14215. TRIM55.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity

  • Note: Nuclear under atrophic conditions and upon mechanical signals. Localizes to the sarcomeric M-band in cardiomyocytes. Colocalizes in part with microtubules (By similarity).By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • microtubule Source: UniProtKB
  • nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34432.

Polymorphism and mutation databases

BioMutaiTRIM55.
DMDMi78099806.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 548548Tripartite motif-containing protein 55PRO_0000056286Add
BLAST

Proteomic databases

MaxQBiQ9BYV6.
PaxDbiQ9BYV6.
PeptideAtlasiQ9BYV6.
PRIDEiQ9BYV6.

PTM databases

iPTMnetiQ9BYV6.
PhosphoSiteiQ9BYV6.

Expressioni

Tissue specificityi

Highly expressed in muscle. Low-level expression in liver.1 Publication

Gene expression databases

BgeeiENSG00000147573.
CleanExiHS_TRIM55.
GenevisibleiQ9BYV6. HS.

Organism-specific databases

HPAiHPA038793.
HPA053691.

Interactioni

Subunit structurei

Homooligomer and heterooligomer (Probable). Interacts with titin/TTN. Interacts with myosins. Interacts with SQSTM1 and NBR1. Isoform 4 may not able to interact with isoform 1, isoform 2 and isoform 3. Probably interacts with TRIM63 and TRIM54.Curated3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-2341179,EBI-2341179

GO - Molecular functioni

  • identical protein binding Source: IntAct

Protein-protein interaction databases

BioGridi124194. 88 interactions.
IntActiQ9BYV6. 14 interactions.
MINTiMINT-4723378.
STRINGi9606.ENSP00000323913.

Structurei

3D structure databases

ProteinModelPortaliQ9BYV6.
SMRiQ9BYV6. Positions 15-108, 123-166, 216-272.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini269 – 32759COSPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili168 – 24881Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 B box-type zinc finger.PROSITE-ProRule annotation
Contains 1 COS domain.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri10 – 6657RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri103 – 14543B box-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410ITG3. Eukaryota.
ENOG410YBZG. LUCA.
GeneTreeiENSGT00760000118878.
HOVERGENiHBG071242.
InParanoidiQ9BYV6.
KOiK10654.
OMAiQIGFEAP.
OrthoDBiEOG091G071N.
PhylomeDBiQ9BYV6.
TreeFamiTF331669.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProiIPR017903. COS_domain.
IPR027370. Znf-RING_LisH.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00643. zf-B_box. 1 hit.
PF13445. zf-RING_UBOX. 1 hit.
[Graphical view]
SMARTiSM00336. BBOX. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS51262. COS. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BYV6-1) [UniParc]FASTAAdd to basket
Also known as: p60

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSASLNYKSF SKEQQTMDNL EKQLICPICL EMFTKPVVIL PCQHNLCRKC
60 70 80 90 100
ASDIFQASNP YLPTRGGTTM ASGGRFRCPS CRHEVVLDRH GVYGLQRNLL
110 120 130 140 150
VENIIDIYKQ ESTRPEKKSD QPMCEEHEEE RINIYCLNCE VPTCSLCKVF
160 170 180 190 200
GAHKDCQVAP LTHVFQRQKS ELSDGIAILV GSNDRVQGVI SQLEDTCKTI
210 220 230 240 250
EECCRKQKQE LCEKFDYLYG ILEERKNEMT QVITRTQEEK LEHVRALIKK
260 270 280 290 300
YSDHLENVSK LVESGIQFMD EPEMAVFLQN AKTLLKKISE ASKAFQMEKI
310 320 330 340 350
EHGYENMNHF TVNLNREEKI IREIDFYRED EDEEEEEGGE GEKEGEGEVG
360 370 380 390 400
GEAVEVEEVE NVQTEFPGED ENPEKASELS QVELQAAPGA LPVSSPEPPP
410 420 430 440 450
ALPPAADAPV TQGEVVPTGS EQTTESETPV PAAAETADPL FYPSWYKGQT
460 470 480 490 500
RKATTNPPCT PGSEGLGQIG PPGSEDSNVR KAEVAAAAAS ERAAVSGKET
510 520 530 540
SAPAATSQIG FEAPPLQGQA AAPASGSGAD SEPARHIFSF SWLNSLNE
Length:548
Mass (Da):60,466
Last modified:October 25, 2005 - v2
Checksum:i2AA2E4D4F5C3E3A1
GO
Isoform 2 (identifier: Q9BYV6-2) [UniParc]FASTAAdd to basket
Also known as: p50

The sequence of this isoform differs from the canonical sequence as follows:
     412-507: Missing.

Show »
Length:452
Mass (Da):50,823
Checksum:i47E656DC77628A45
GO
Isoform 3 (identifier: Q9BYV6-3) [UniParc]FASTAAdd to basket
Also known as: p60B

The sequence of this isoform differs from the canonical sequence as follows:
     509-548: IGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE → ELVICLALLAFLILHYIWSQIQCLIFTLMDWI

Show »
Length:540
Mass (Da):60,174
Checksum:i5F017CFB82982E81
GO
Isoform 4 (identifier: Q9BYV6-4) [UniParc]FASTAAdd to basket
Also known as: p27

The sequence of this isoform differs from the canonical sequence as follows:
     202-508: Missing.

Show »
Length:241
Mass (Da):26,841
Checksum:i21951B79C1B89B37
GO

Sequence cautioni

The sequence AAP35876 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAC32839 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAC32840 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti102 – 1021E → G in CAC43019 (PubMed:12414993).Curated
Sequence conflicti102 – 1021E → G in CAC43020 (PubMed:12414993).Curated
Sequence conflicti345 – 3451G → E in CAC43019 (PubMed:12414993).Curated
Sequence conflicti345 – 3451G → E in CAC43020 (PubMed:12414993).Curated
Sequence conflicti345 – 3451G → E in CAD24432 (PubMed:12414993).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti50 – 501C → Y Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication
VAR_074078
Natural varianti54 – 541I → V.1 Publication
VAR_074079
Natural varianti79 – 791P → A Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication
Corresponds to variant rs769797275 [ dbSNP | Ensembl ].
VAR_074080
Natural varianti241 – 2411L → M Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication
VAR_074081
Natural varianti252 – 2521S → F.1 Publication
VAR_074082
Natural varianti257 – 2571N → K.1 Publication
VAR_074083
Natural varianti258 – 2581V → I.1 Publication
VAR_074084
Natural varianti336 – 3361E → Q.1 Publication
Corresponds to variant rs770907206 [ dbSNP | Ensembl ].
VAR_074085
Natural varianti343 – 3431K → R.1 Publication
Corresponds to variant rs7843605 [ dbSNP | Ensembl ].
VAR_052144
Natural varianti392 – 3921P → T Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication
Corresponds to variant rs200545859 [ dbSNP | Ensembl ].
VAR_074086
Natural varianti418 – 4181T → I.1 Publication
VAR_074087
Natural varianti452 – 4521K → N Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication
Corresponds to variant rs755876598 [ dbSNP | Ensembl ].
VAR_074088
Natural varianti458 – 4581P → L.1 Publication
VAR_074089
Natural varianti488 – 4881A → T.1 Publication
Corresponds to variant rs770146015 [ dbSNP | Ensembl ].
VAR_074090
Natural varianti506 – 5061T → S Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication
Corresponds to variant rs781152511 [ dbSNP | Ensembl ].
VAR_074091
Isoform 3 (identifier: Q9BYV6-3)
Natural varianti523 – 5231H → R.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei202 – 508307Missing in isoform 4. 1 PublicationVSP_015996Add
BLAST
Alternative sequencei412 – 50796Missing in isoform 2. 5 PublicationsVSP_015997Add
BLAST
Alternative sequencei509 – 54840IGFEA…NSLNE → ELVICLALLAFLILHYIWSQ IQCLIFTLMDWI in isoform 3. 1 PublicationVSP_015998Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ291712 mRNA. Translation: CAC32839.1. Different initiation.
AJ291712 mRNA. Translation: CAC32840.1. Different initiation.
AJ243488 mRNA. Translation: CAC43019.1.
AJ243489 mRNA. Translation: CAC43020.1.
AJ277493 mRNA. Translation: CAC81835.1.
AJ431704 mRNA. Translation: CAD24432.1.
AK091310 mRNA. Translation: BAG52332.1.
AK091728 mRNA. Translation: BAG52405.1.
CH471068 Genomic DNA. Translation: EAW86894.1.
CH471068 Genomic DNA. Translation: EAW86895.1.
BC007750 mRNA. Translation: AAH07750.2.
BT007212 mRNA. Translation: AAP35876.1. Different initiation.
CCDSiCCDS6184.1. [Q9BYV6-1]
CCDS6185.1. [Q9BYV6-2]
CCDS6186.1. [Q9BYV6-4]
CCDS6187.1. [Q9BYV6-3]
RefSeqiNP_149047.2. NM_033058.2. [Q9BYV6-3]
NP_908973.1. NM_184085.1. [Q9BYV6-1]
NP_908974.1. NM_184086.1. [Q9BYV6-2]
NP_908975.1. NM_184087.1. [Q9BYV6-4]
XP_011515915.1. XM_011517613.2. [Q9BYV6-1]
XP_011515916.1. XM_011517614.2. [Q9BYV6-1]
XP_011515917.1. XM_011517615.2. [Q9BYV6-3]
XP_011515918.1. XM_011517616.2. [Q9BYV6-2]
UniGeneiHs.85524.

Genome annotation databases

EnsembliENST00000276573; ENSP00000276573; ENSG00000147573. [Q9BYV6-3]
ENST00000315962; ENSP00000323913; ENSG00000147573. [Q9BYV6-1]
ENST00000350034; ENSP00000332302; ENSG00000147573. [Q9BYV6-4]
ENST00000353317; ENSP00000297348; ENSG00000147573. [Q9BYV6-2]
GeneIDi84675.
KEGGihsa:84675.
UCSCiuc003xvu.4. human. [Q9BYV6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ291712 mRNA. Translation: CAC32839.1. Different initiation.
AJ291712 mRNA. Translation: CAC32840.1. Different initiation.
AJ243488 mRNA. Translation: CAC43019.1.
AJ243489 mRNA. Translation: CAC43020.1.
AJ277493 mRNA. Translation: CAC81835.1.
AJ431704 mRNA. Translation: CAD24432.1.
AK091310 mRNA. Translation: BAG52332.1.
AK091728 mRNA. Translation: BAG52405.1.
CH471068 Genomic DNA. Translation: EAW86894.1.
CH471068 Genomic DNA. Translation: EAW86895.1.
BC007750 mRNA. Translation: AAH07750.2.
BT007212 mRNA. Translation: AAP35876.1. Different initiation.
CCDSiCCDS6184.1. [Q9BYV6-1]
CCDS6185.1. [Q9BYV6-2]
CCDS6186.1. [Q9BYV6-4]
CCDS6187.1. [Q9BYV6-3]
RefSeqiNP_149047.2. NM_033058.2. [Q9BYV6-3]
NP_908973.1. NM_184085.1. [Q9BYV6-1]
NP_908974.1. NM_184086.1. [Q9BYV6-2]
NP_908975.1. NM_184087.1. [Q9BYV6-4]
XP_011515915.1. XM_011517613.2. [Q9BYV6-1]
XP_011515916.1. XM_011517614.2. [Q9BYV6-1]
XP_011515917.1. XM_011517615.2. [Q9BYV6-3]
XP_011515918.1. XM_011517616.2. [Q9BYV6-2]
UniGeneiHs.85524.

3D structure databases

ProteinModelPortaliQ9BYV6.
SMRiQ9BYV6. Positions 15-108, 123-166, 216-272.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124194. 88 interactions.
IntActiQ9BYV6. 14 interactions.
MINTiMINT-4723378.
STRINGi9606.ENSP00000323913.

PTM databases

iPTMnetiQ9BYV6.
PhosphoSiteiQ9BYV6.

Polymorphism and mutation databases

BioMutaiTRIM55.
DMDMi78099806.

Proteomic databases

MaxQBiQ9BYV6.
PaxDbiQ9BYV6.
PeptideAtlasiQ9BYV6.
PRIDEiQ9BYV6.

Protocols and materials databases

DNASUi84675.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000276573; ENSP00000276573; ENSG00000147573. [Q9BYV6-3]
ENST00000315962; ENSP00000323913; ENSG00000147573. [Q9BYV6-1]
ENST00000350034; ENSP00000332302; ENSG00000147573. [Q9BYV6-4]
ENST00000353317; ENSP00000297348; ENSG00000147573. [Q9BYV6-2]
GeneIDi84675.
KEGGihsa:84675.
UCSCiuc003xvu.4. human. [Q9BYV6-1]

Organism-specific databases

CTDi84675.
GeneCardsiTRIM55.
HGNCiHGNC:14215. TRIM55.
HPAiHPA038793.
HPA053691.
MIMi606469. gene.
neXtProtiNX_Q9BYV6.
PharmGKBiPA34432.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ITG3. Eukaryota.
ENOG410YBZG. LUCA.
GeneTreeiENSGT00760000118878.
HOVERGENiHBG071242.
InParanoidiQ9BYV6.
KOiK10654.
OMAiQIGFEAP.
OrthoDBiEOG091G071N.
PhylomeDBiQ9BYV6.
TreeFamiTF331669.

Miscellaneous databases

ChiTaRSiTRIM55. human.
GeneWikiiTRIM55.
GenomeRNAii84675.
PROiQ9BYV6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000147573.
CleanExiHS_TRIM55.
GenevisibleiQ9BYV6. HS.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProiIPR017903. COS_domain.
IPR027370. Znf-RING_LisH.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00643. zf-B_box. 1 hit.
PF13445. zf-RING_UBOX. 1 hit.
[Graphical view]
SMARTiSM00336. BBOX. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS51262. COS. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTRI55_HUMAN
AccessioniPrimary (citable) accession number: Q9BYV6
Secondary accession number(s): B3KRC0
, B3KRJ3, Q53XX3, Q8IUD9, Q8IUE4, Q96DV2, Q96DV3, Q9BYV5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: October 25, 2005
Last modified: September 7, 2016
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.Curated
Variant Arg-343 is erroneously reported as Trp-343 in PubMed:24865491.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.