Q9BYV6 (TRI55_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tripartite motif-containing protein 55 Alternative name(s): Muscle-specific RING finger protein 2 Short name=MuRF-2 Short name=MuRF2 RING finger protein 29 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 548 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May regulate gene expression and protein turnover in muscle cells By similarity. |
| Subunit structure | Homooligomer and heterooligomer Probable. Interacts with titin/TTN. Interacts with myosins. Interacts with SQSTM1 and NBR1. Isoform 4 may not able to interact with isoform 1, isoform 2 and isoform 3. Probably interacts with TRIM63 and TRIM54. Ref.1 Ref.2 Ref.7 |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: Nuclear under atrophic conditions and upon mechanical signals. Localizes to the sarcomeric M-band in cardiomyocytes. Colocalizes in part with microtubules By similarity. |
| Tissue specificity | Highly expressed in muscle. Low-level expression in liver. Ref.1 |
| Sequence similarities | Contains 1 B box-type zinc finger. Contains 1 COS domain. Contains 1 RING-type zinc finger. |
| Caution | It is uncertain whether Met-1 or Met-17 is the initiator. |
| Sequence caution | The sequence AAP35876.1 differs from that shown. Reason: Erroneous initiation. The sequence CAC32839.1 differs from that shown. Reason: Erroneous initiation. The sequence CAC32840.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Muscle protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell microtubuleNon-traceable author statement Ref.1. Source: UniProtKB nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | signal transducer activity Non-traceable author statement Ref.1. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-2341179,EBI-2341179 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BYV6-1) Also known as: p60; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BYV6-2) Also known as: p50; The sequence of this isoform differs from the canonical sequence as follows: 412-507: Missing. | ||||||
| Isoform 3 (identifier: Q9BYV6-3) Also known as: p60B; The sequence of this isoform differs from the canonical sequence as follows: 509-548: IGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE → ELVICLALLAFLILHYIWSQIQCLIFTLMDWI | ||||||
| Isoform 4 (identifier: Q9BYV6-4) Also known as: p27; The sequence of this isoform differs from the canonical sequence as follows: 202-508: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 548 | 548 | Tripartite motif-containing protein 55 | PRO_0000056286 | |||||
Regions | |||||||||
| Domain | 269 – 327 | 59 | COS | ||||||
| Zinc finger | 10 – 66 | 57 | RING-type | ||||||
| Zinc finger | 103 – 145 | 43 | B box-type | ||||||
| Coiled coil | 168 – 248 | 81 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 202 – 508 | 307 | Missing in isoform 4. | VSP_015996 | |||||
| Alternative sequence | 412 – 507 | 96 | Missing in isoform 2. | VSP_015997 | |||||
| Alternative sequence | 509 – 548 | 40 | IGFEA…NSLNE → ELVICLALLAFLILHYIWSQ IQCLIFTLMDWI in isoform 3. | VSP_015998 | |||||
| Natural variant | 343 | 1 | K → R. Corresponds to variant rs7843605 [ dbSNP | Ensembl ]. | VAR_052144 | |||||
Experimental info | |||||||||
| Sequence conflict | 102 | 1 | E → G in CAC43019. Ref.2 | ||||||
| Sequence conflict | 102 | 1 | E → G in CAC43020. Ref.2 | ||||||
| Sequence conflict | 345 | 1 | G → E in CAC43019. Ref.2 | ||||||
| Sequence conflict | 345 | 1 | G → E in CAC43020. Ref.2 | ||||||
| Sequence conflict | 345 | 1 | G → E in CAD24432. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of muscle specific ring finger proteins as potential regulators of the titin kinase domain." Centner T., Yano J., Kimura E., McElhinny A.S., Pelin K., Witt C.C., Bang M.-L., Trombitas K., Granzier H., Gregorio C.C., Sorimachi H., Labeit S. J. Mol. Biol. 306:717-726(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, INTERACTION WITH TRIM63 AND TRIM54. Tissue: Heart. |
| [2] | "Transient association of titin and myosin with microtubules in nascent myofibrils directed by the MURF2 RING-finger protein." Pizon V., Iakovenko A., van der Ven P.F.M., Kelly R., Fatu C., Fuerst D.O., Karsenti E., Gautel M. J. Cell Sci. 115:4469-4482(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), OLIGOMERIZATION, INTERACTION WITH TTN AND MYOSIN. Tissue: Heart muscle and Skeletal muscle. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Heart. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Muscle. |
| [6] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-548 (ISOFORM 2). |
| [7] | "The kinase domain of titin controls muscle gene expression and protein turnover." Lange S., Xiang F., Yakovenko A., Vihola A., Hackman P., Rostkova E., Kristensen J., Brandmeier B., Franzen G., Hedberg B., Gunnarsson L.G., Hughes S.M., Marchand S., Sejersen T., Richard I., Edstroem L., Ehler E., Udd B., Gautel M. Science 308:1599-1603(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TTN; SQSTM1 AND NBR1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ291712 mRNA. Translation: CAC32839.1. Different initiation. AJ291712 mRNA. Translation: CAC32840.1. Different initiation. AJ243488 mRNA. Translation: CAC43019.1. AJ243489 mRNA. Translation: CAC43020.1. AJ277493 mRNA. Translation: CAC81835.1. AJ431704 mRNA. Translation: CAD24432.1. AK091310 mRNA. Translation: BAG52332.1. AK091728 mRNA. Translation: BAG52405.1. CH471068 Genomic DNA. Translation: EAW86894.1. CH471068 Genomic DNA. Translation: EAW86895.1. BC007750 mRNA. Translation: AAH07750.2. BT007212 mRNA. Translation: AAP35876.1. Different initiation. |
| IPI | IPI00011473. IPI00216729. IPI00375443. IPI00375444. |
| RefSeq | NP_149047.2. NM_033058.2. NP_908973.1. NM_184085.1. NP_908974.1. NM_184086.1. NP_908975.1. NM_184087.1. |
| UniGene | Hs.85524. |
3D structure databases | |
| ProteinModelPortal | Q9BYV6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BYV6. 11 interactions. |
| MINT | MINT-4723378. |
PTM databases | |
| PhosphoSite | Q9BYV6. |
Polymorphism databases | |
| DMDM | 78099806. |
Proteomic databases | |
| PaxDb | Q9BYV6. |
| PRIDE | Q9BYV6. |
Protocols and materials databases | |
| DNASU | 84675. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000276573; ENSP00000276573; ENSG00000147573. ENST00000315962; ENSP00000323913; ENSG00000147573. ENST00000350034; ENSP00000332302; ENSG00000147573. ENST00000353317; ENSP00000297348; ENSG00000147573. |
| GeneID | 84675. |
| KEGG | hsa:84675. |
| UCSC | uc003xvu.3. human. uc003xvv.3. human. uc003xvw.3. human. uc003xvx.3. human. |
Organism-specific databases | |
| CTD | 84675. |
| GeneCards | GC08P067039. |
| HGNC | HGNC:14215. TRIM55. |
| HPA | HPA038793. |
| MIM | 606469. gene. |
| neXtProt | NX_Q9BYV6. |
| PharmGKB | PA34432. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG310224. |
| HOVERGEN | HBG071242. |
| InParanoid | Q9BYV6. |
| KO | K10654. |
| OMA | EIDFYRE. |
| OrthoDB | EOG4WQ12R. |
| PhylomeDB | Q9BYV6. |
Gene expression databases | |
| Bgee | Q9BYV6. |
| CleanEx | HS_TRIM55. |
| Genevestigator | Q9BYV6. |
| GermOnline | ENSG00000147573. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR017903. COS_domain. IPR000315. Znf_B-box. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] |
| Pfam | PF00643. zf-B_box. 1 hit. [Graphical view] |
| SMART | SM00336. BBOX. 1 hit. SM00184. RING. 1 hit. [Graphical view] |
| PROSITE | PS51262. COS. 1 hit. PS50119. ZF_BBOX. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84675. |
| NextBio | 74689. |
| SOURCE | Search... |
Entry information
| Entry name | TRI55_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BYV6 Secondary accession number(s): B3KRC0 Q9BYV5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
