Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tripartite motif-containing protein 55

Gene

TRIM55

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May regulate gene expression and protein turnover in muscle cells.By similarity

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.Curated
Variant Arg-343 is erroneously reported as Trp-343 in PubMed:24865491.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri10 – 66RING-typePROSITE-ProRule annotationAdd BLAST57
Zinc fingeri103 – 145B box-typePROSITE-ProRule annotationAdd BLAST43

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • zinc ion binding Source: InterPro

GO - Biological processi

  • signal transduction Source: UniProtKB

Keywordsi

Molecular functionMuscle protein
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Tripartite motif-containing protein 55
Alternative name(s):
Muscle-specific RING finger protein 2
Short name:
MuRF-2
Short name:
MuRF2
RING finger protein 29
Gene namesi
Name:TRIM55
Synonyms:MURF2, RNF29
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000147573.16
HGNCiHGNC:14215 TRIM55
MIMi606469 gene
neXtProtiNX_Q9BYV6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84675
OpenTargetsiENSG00000147573
PharmGKBiPA34432

Polymorphism and mutation databases

BioMutaiTRIM55
DMDMi78099806

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000562861 – 548Tripartite motif-containing protein 55Add BLAST548

Proteomic databases

MaxQBiQ9BYV6
PaxDbiQ9BYV6
PeptideAtlasiQ9BYV6
PRIDEiQ9BYV6
ProteomicsDBi79714
79715 [Q9BYV6-2]
79716 [Q9BYV6-3]
79717 [Q9BYV6-4]

PTM databases

iPTMnetiQ9BYV6
PhosphoSitePlusiQ9BYV6

Expressioni

Tissue specificityi

Highly expressed in muscle. Low-level expression in liver.1 Publication

Gene expression databases

BgeeiENSG00000147573
CleanExiHS_TRIM55
GenevisibleiQ9BYV6 HS

Organism-specific databases

HPAiHPA038793
HPA053691

Interactioni

Subunit structurei

Homooligomer and heterooligomer (Probable). Interacts with titin/TTN. Interacts with myosins. Interacts with SQSTM1 and NBR1. Isoform 4 may not able to interact with isoform 1, isoform 2 and isoform 3. Probably interacts with TRIM63 and TRIM54.Curated3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-2341179,EBI-2341179

GO - Molecular functioni

  • identical protein binding Source: IntAct

Protein-protein interaction databases

BioGridi124194, 95 interactors
IntActiQ9BYV6, 15 interactors
MINTiQ9BYV6
STRINGi9606.ENSP00000323913

Structurei

3D structure databases

ProteinModelPortaliQ9BYV6
SMRiQ9BYV6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini269 – 327COSPROSITE-ProRule annotationAdd BLAST59

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili168 – 248Sequence analysisAdd BLAST81

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri10 – 66RING-typePROSITE-ProRule annotationAdd BLAST57
Zinc fingeri103 – 145B box-typePROSITE-ProRule annotationAdd BLAST43

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410ITG3 Eukaryota
ENOG410YBZG LUCA
GeneTreeiENSGT00760000118878
HOVERGENiHBG071242
InParanoidiQ9BYV6
KOiK10654
OMAiCKTIEEC
OrthoDBiEOG091G071N
PhylomeDBiQ9BYV6
TreeFamiTF331669

Family and domain databases

CDDicd00021 BBOX, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR017903 COS_domain
IPR027370 Znf-RING_LisH
IPR000315 Znf_B-box
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PfamiView protein in Pfam
PF00643 zf-B_box, 1 hit
PF13445 zf-RING_UBOX, 1 hit
SMARTiView protein in SMART
SM00336 BBOX, 1 hit
SM00184 RING, 1 hit
PROSITEiView protein in PROSITE
PS51262 COS, 1 hit
PS50119 ZF_BBOX, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BYV6-1) [UniParc]FASTAAdd to basket
Also known as: p60

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSASLNYKSF SKEQQTMDNL EKQLICPICL EMFTKPVVIL PCQHNLCRKC
60 70 80 90 100
ASDIFQASNP YLPTRGGTTM ASGGRFRCPS CRHEVVLDRH GVYGLQRNLL
110 120 130 140 150
VENIIDIYKQ ESTRPEKKSD QPMCEEHEEE RINIYCLNCE VPTCSLCKVF
160 170 180 190 200
GAHKDCQVAP LTHVFQRQKS ELSDGIAILV GSNDRVQGVI SQLEDTCKTI
210 220 230 240 250
EECCRKQKQE LCEKFDYLYG ILEERKNEMT QVITRTQEEK LEHVRALIKK
260 270 280 290 300
YSDHLENVSK LVESGIQFMD EPEMAVFLQN AKTLLKKISE ASKAFQMEKI
310 320 330 340 350
EHGYENMNHF TVNLNREEKI IREIDFYRED EDEEEEEGGE GEKEGEGEVG
360 370 380 390 400
GEAVEVEEVE NVQTEFPGED ENPEKASELS QVELQAAPGA LPVSSPEPPP
410 420 430 440 450
ALPPAADAPV TQGEVVPTGS EQTTESETPV PAAAETADPL FYPSWYKGQT
460 470 480 490 500
RKATTNPPCT PGSEGLGQIG PPGSEDSNVR KAEVAAAAAS ERAAVSGKET
510 520 530 540
SAPAATSQIG FEAPPLQGQA AAPASGSGAD SEPARHIFSF SWLNSLNE
Length:548
Mass (Da):60,466
Last modified:October 25, 2005 - v2
Checksum:i2AA2E4D4F5C3E3A1
GO
Isoform 2 (identifier: Q9BYV6-2) [UniParc]FASTAAdd to basket
Also known as: p50

The sequence of this isoform differs from the canonical sequence as follows:
     412-507: Missing.

Show »
Length:452
Mass (Da):50,823
Checksum:i47E656DC77628A45
GO
Isoform 3 (identifier: Q9BYV6-3) [UniParc]FASTAAdd to basket
Also known as: p60B

The sequence of this isoform differs from the canonical sequence as follows:
     509-548: IGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE → ELVICLALLAFLILHYIWSQIQCLIFTLMDWI

Show »
Length:540
Mass (Da):60,174
Checksum:i5F017CFB82982E81
GO
Isoform 4 (identifier: Q9BYV6-4) [UniParc]FASTAAdd to basket
Also known as: p27

The sequence of this isoform differs from the canonical sequence as follows:
     202-508: Missing.

Show »
Length:241
Mass (Da):26,841
Checksum:i21951B79C1B89B37
GO

Sequence cautioni

The sequence AAP35876 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAC32839 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAC32840 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti102E → G in CAC43019 (PubMed:12414993).Curated1
Sequence conflicti102E → G in CAC43020 (PubMed:12414993).Curated1
Sequence conflicti345G → E in CAC43019 (PubMed:12414993).Curated1
Sequence conflicti345G → E in CAC43020 (PubMed:12414993).Curated1
Sequence conflicti345G → E in CAD24432 (PubMed:12414993).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07407850C → Y Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication1
Natural variantiVAR_07407954I → V1 Publication1
Natural variantiVAR_07408079P → A Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs769797275Ensembl.1
Natural variantiVAR_074081241L → M Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication1
Natural variantiVAR_074082252S → F1 Publication1
Natural variantiVAR_074083257N → K1 PublicationCorresponds to variant dbSNP:rs61741078Ensembl.1
Natural variantiVAR_074084258V → I1 Publication1
Natural variantiVAR_074085336E → Q1 PublicationCorresponds to variant dbSNP:rs770907206Ensembl.1
Natural variantiVAR_052144343K → R1 PublicationCorresponds to variant dbSNP:rs7843605Ensembl.1
Natural variantiVAR_074086392P → T Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs200545859Ensembl.1
Natural variantiVAR_074087418T → I1 Publication1
Natural variantiVAR_074088452K → N Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs755876598Ensembl.1
Natural variantiVAR_074089458P → L1 Publication1
Natural variantiVAR_074090488A → T1 PublicationCorresponds to variant dbSNP:rs770146015Ensembl.1
Natural variantiVAR_074091506T → S Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs781152511Ensembl.1
Isoform 3 (identifier: Q9BYV6-3)
Natural varianti523H → R1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015996202 – 508Missing in isoform 4. 1 PublicationAdd BLAST307
Alternative sequenceiVSP_015997412 – 507Missing in isoform 2. 5 PublicationsAdd BLAST96
Alternative sequenceiVSP_015998509 – 548IGFEA…NSLNE → ELVICLALLAFLILHYIWSQ IQCLIFTLMDWI in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ291712 mRNA Translation: CAC32839.1 Different initiation.
AJ291712 mRNA Translation: CAC32840.1 Different initiation.
AJ243488 mRNA Translation: CAC43019.1
AJ243489 mRNA Translation: CAC43020.1
AJ277493 mRNA Translation: CAC81835.1
AJ431704 mRNA Translation: CAD24432.1
AK091310 mRNA Translation: BAG52332.1
AK091728 mRNA Translation: BAG52405.1
CH471068 Genomic DNA Translation: EAW86894.1
CH471068 Genomic DNA Translation: EAW86895.1
BC007750 mRNA Translation: AAH07750.2
BT007212 mRNA Translation: AAP35876.1 Different initiation.
CCDSiCCDS6184.1 [Q9BYV6-1]
CCDS6185.1 [Q9BYV6-2]
CCDS6186.1 [Q9BYV6-4]
CCDS6187.1 [Q9BYV6-3]
RefSeqiNP_149047.2, NM_033058.2 [Q9BYV6-3]
NP_908973.1, NM_184085.1 [Q9BYV6-1]
NP_908974.1, NM_184086.1 [Q9BYV6-2]
NP_908975.1, NM_184087.1 [Q9BYV6-4]
XP_011515915.1, XM_011517613.2 [Q9BYV6-1]
XP_011515916.1, XM_011517614.2 [Q9BYV6-1]
XP_011515917.1, XM_011517615.2 [Q9BYV6-3]
XP_011515918.1, XM_011517616.2 [Q9BYV6-2]
UniGeneiHs.85524

Genome annotation databases

EnsembliENST00000276573; ENSP00000276573; ENSG00000147573 [Q9BYV6-3]
ENST00000315962; ENSP00000323913; ENSG00000147573 [Q9BYV6-1]
ENST00000350034; ENSP00000332302; ENSG00000147573 [Q9BYV6-4]
ENST00000353317; ENSP00000297348; ENSG00000147573 [Q9BYV6-2]
GeneIDi84675
KEGGihsa:84675
UCSCiuc003xvu.4 human [Q9BYV6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTRI55_HUMAN
AccessioniPrimary (citable) accession number: Q9BYV6
Secondary accession number(s): B3KRC0
, B3KRJ3, Q53XX3, Q8IUD9, Q8IUE4, Q96DV2, Q96DV3, Q9BYV5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: October 25, 2005
Last modified: June 20, 2018
This is version 154 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health