Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BYV6 (TRI55_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tripartite motif-containing protein 55
Alternative name(s):
Muscle-specific RING finger protein 2
Short name=MuRF-2
Short name=MuRF2
RING finger protein 29
Gene names
Name:TRIM55
Synonyms:MURF2, RNF29
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length548 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May regulate gene expression and protein turnover in muscle cells By similarity.

Subunit structure

Homooligomer and heterooligomer Probable. Interacts with titin/TTN. Interacts with myosins. Interacts with SQSTM1 and NBR1. Isoform 4 may not able to interact with isoform 1, isoform 2 and isoform 3. Probably interacts with TRIM63 and TRIM54. Ref.1 Ref.2 Ref.7

Subcellular location

Cytoplasm By similarity. Nucleus By similarity. Note: Nuclear under atrophic conditions and upon mechanical signals. Localizes to the sarcomeric M-band in cardiomyocytes. Colocalizes in part with microtubules By similarity.

Tissue specificity

Highly expressed in muscle. Low-level expression in liver. Ref.1

Sequence similarities

Contains 1 B box-type zinc finger.

Contains 1 COS domain.

Contains 1 RING-type zinc finger.

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.

Sequence caution

The sequence AAP35876.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAC32839.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAC32840.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
Zinc-finger
   LigandMetal-binding
Zinc
   Molecular functionMuscle protein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processsignal transduction

Non-traceable author statement Ref.1. Source: UniProtKB

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

microtubule

Non-traceable author statement Ref.1. Source: UniProtKB

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionidentical protein binding

Inferred from physical interaction PubMed 22493164. Source: IntAct

signal transducer activity

Non-traceable author statement Ref.1. Source: UniProtKB

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

itself2EBI-2341179,EBI-2341179

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BYV6-1)

Also known as: p60;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BYV6-2)

Also known as: p50;

The sequence of this isoform differs from the canonical sequence as follows:
     412-507: Missing.
Isoform 3 (identifier: Q9BYV6-3)

Also known as: p60B;

The sequence of this isoform differs from the canonical sequence as follows:
     509-548: IGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE → ELVICLALLAFLILHYIWSQIQCLIFTLMDWI
Isoform 4 (identifier: Q9BYV6-4)

Also known as: p27;

The sequence of this isoform differs from the canonical sequence as follows:
     202-508: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 548548Tripartite motif-containing protein 55
PRO_0000056286

Regions

Domain269 – 32759COS
Zinc finger10 – 6657RING-type
Zinc finger103 – 14543B box-type
Coiled coil168 – 24881 Potential

Natural variations

Alternative sequence202 – 508307Missing in isoform 4.
VSP_015996
Alternative sequence412 – 50796Missing in isoform 2.
VSP_015997
Alternative sequence509 – 54840IGFEA…NSLNE → ELVICLALLAFLILHYIWSQ IQCLIFTLMDWI in isoform 3.
VSP_015998
Natural variant3431K → R.
Corresponds to variant rs7843605 [ dbSNP | Ensembl ].
VAR_052144

Experimental info

Sequence conflict1021E → G in CAC43019. Ref.2
Sequence conflict1021E → G in CAC43020. Ref.2
Sequence conflict3451G → E in CAC43019. Ref.2
Sequence conflict3451G → E in CAC43020. Ref.2
Sequence conflict3451G → E in CAD24432. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (p60) [UniParc].

Last modified October 25, 2005. Version 2.
Checksum: 2AA2E4D4F5C3E3A1

FASTA54860,466
        10         20         30         40         50         60 
MSASLNYKSF SKEQQTMDNL EKQLICPICL EMFTKPVVIL PCQHNLCRKC ASDIFQASNP 

        70         80         90        100        110        120 
YLPTRGGTTM ASGGRFRCPS CRHEVVLDRH GVYGLQRNLL VENIIDIYKQ ESTRPEKKSD 

       130        140        150        160        170        180 
QPMCEEHEEE RINIYCLNCE VPTCSLCKVF GAHKDCQVAP LTHVFQRQKS ELSDGIAILV 

       190        200        210        220        230        240 
GSNDRVQGVI SQLEDTCKTI EECCRKQKQE LCEKFDYLYG ILEERKNEMT QVITRTQEEK 

       250        260        270        280        290        300 
LEHVRALIKK YSDHLENVSK LVESGIQFMD EPEMAVFLQN AKTLLKKISE ASKAFQMEKI 

       310        320        330        340        350        360 
EHGYENMNHF TVNLNREEKI IREIDFYRED EDEEEEEGGE GEKEGEGEVG GEAVEVEEVE 

       370        380        390        400        410        420 
NVQTEFPGED ENPEKASELS QVELQAAPGA LPVSSPEPPP ALPPAADAPV TQGEVVPTGS 

       430        440        450        460        470        480 
EQTTESETPV PAAAETADPL FYPSWYKGQT RKATTNPPCT PGSEGLGQIG PPGSEDSNVR 

       490        500        510        520        530        540 
KAEVAAAAAS ERAAVSGKET SAPAATSQIG FEAPPLQGQA AAPASGSGAD SEPARHIFSF 


SWLNSLNE 

« Hide

Isoform 2 (p50) [UniParc].

Checksum: 47E656DC77628A45
Show »

FASTA45250,823
Isoform 3 (p60B) [UniParc].

Checksum: 5F017CFB82982E81
Show »

FASTA54060,174
Isoform 4 (p27) [UniParc].

Checksum: 21951B79C1B89B37
Show »

FASTA24126,841

References

« Hide 'large scale' references
[1]"Identification of muscle specific ring finger proteins as potential regulators of the titin kinase domain."
Centner T., Yano J., Kimura E., McElhinny A.S., Pelin K., Witt C.C., Bang M.-L., Trombitas K., Granzier H., Gregorio C.C., Sorimachi H., Labeit S.
J. Mol. Biol. 306:717-726(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, INTERACTION WITH TRIM63 AND TRIM54.
Tissue: Heart.
[2]"Transient association of titin and myosin with microtubules in nascent myofibrils directed by the MURF2 RING-finger protein."
Pizon V., Iakovenko A., van der Ven P.F.M., Kelly R., Fatu C., Fuerst D.O., Karsenti E., Gautel M.
J. Cell Sci. 115:4469-4482(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), OLIGOMERIZATION, INTERACTION WITH TTN AND MYOSIN.
Tissue: Heart muscle and Skeletal muscle.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Heart.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Muscle.
[6]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 17-548 (ISOFORM 2).
[7]"The kinase domain of titin controls muscle gene expression and protein turnover."
Lange S., Xiang F., Yakovenko A., Vihola A., Hackman P., Rostkova E., Kristensen J., Brandmeier B., Franzen G., Hedberg B., Gunnarsson L.G., Hughes S.M., Marchand S., Sejersen T., Richard I., Edstroem L., Ehler E., Udd B., Gautel M.
Science 308:1599-1603(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TTN; SQSTM1 AND NBR1.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ291712 mRNA. Translation: CAC32839.1. Different initiation.
AJ291712 mRNA. Translation: CAC32840.1. Different initiation.
AJ243488 mRNA. Translation: CAC43019.1.
AJ243489 mRNA. Translation: CAC43020.1.
AJ277493 mRNA. Translation: CAC81835.1.
AJ431704 mRNA. Translation: CAD24432.1.
AK091310 mRNA. Translation: BAG52332.1.
AK091728 mRNA. Translation: BAG52405.1.
CH471068 Genomic DNA. Translation: EAW86894.1.
CH471068 Genomic DNA. Translation: EAW86895.1.
BC007750 mRNA. Translation: AAH07750.2.
BT007212 mRNA. Translation: AAP35876.1. Different initiation.
RefSeqNP_149047.2. NM_033058.2.
NP_908973.1. NM_184085.1.
NP_908974.1. NM_184086.1.
NP_908975.1. NM_184087.1.
UniGeneHs.85524.

3D structure databases

ProteinModelPortalQ9BYV6.
SMRQ9BYV6. Positions 15-166.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124194. 54 interactions.
IntActQ9BYV6. 14 interactions.
MINTMINT-4723378.

PTM databases

PhosphoSiteQ9BYV6.

Polymorphism databases

DMDM78099806.

Proteomic databases

PaxDbQ9BYV6.
PRIDEQ9BYV6.

Protocols and materials databases

DNASU84675.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000276573; ENSP00000276573; ENSG00000147573. [Q9BYV6-3]
ENST00000315962; ENSP00000323913; ENSG00000147573. [Q9BYV6-1]
ENST00000350034; ENSP00000332302; ENSG00000147573. [Q9BYV6-4]
ENST00000353317; ENSP00000297348; ENSG00000147573. [Q9BYV6-2]
GeneID84675.
KEGGhsa:84675.
UCSCuc003xvu.3. human. [Q9BYV6-3]
uc003xvv.3. human. [Q9BYV6-1]
uc003xvw.3. human. [Q9BYV6-2]
uc003xvx.3. human. [Q9BYV6-4]

Organism-specific databases

CTD84675.
GeneCardsGC08P067039.
HGNCHGNC:14215. TRIM55.
HPAHPA038793.
HPA053691.
MIM606469. gene.
neXtProtNX_Q9BYV6.
PharmGKBPA34432.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG310224.
HOVERGENHBG071242.
InParanoidQ9BYV6.
KOK10654.
OMAEIDFYRE.
OrthoDBEOG7VDXPK.
PhylomeDBQ9BYV6.
TreeFamTF331669.

Gene expression databases

BgeeQ9BYV6.
CleanExHS_TRIM55.
GenevestigatorQ9BYV6.

Family and domain databases

Gene3D3.30.40.10. 1 hit.
4.10.45.10. 1 hit.
InterProIPR017903. COS_domain.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamPF00643. zf-B_box. 1 hit.
[Graphical view]
SMARTSM00336. BBOX. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
PROSITEPS51262. COS. 1 hit.
PS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiTRIM55.
GenomeRNAi84675.
NextBio74689.
PROQ9BYV6.
SOURCESearch...

Entry information

Entry nameTRI55_HUMAN
AccessionPrimary (citable) accession number: Q9BYV6
Secondary accession number(s): B3KRC0 expand/collapse secondary AC list , B3KRJ3, Q53XX3, Q8IUD9, Q8IUE4, Q96DV2, Q96DV3, Q9BYV5
Entry history
Integrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: October 25, 2005
Last modified: April 16, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM