Reviewed,
UniProtKB/Swiss-Prot Q9BYP7 (WNK3_HUMAN)
Last modified
February 9, 2010.
Version 80.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase WNK3 EC=2.7.11.1 Alternative name(s): Protein kinase with no lysine 3 Protein kinase lysine-deficient 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1743 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. UniProtKB Q9H4A3 |
| Cofactor | Magnesium By similarity. UniProtKB Q9H4A3 |
| Enzyme regulation | Activation requires autophosphorylation of Ser-308. Phosphorylation of Ser-304 also promotes increased activity By similarity. UniProtKB Q9JIH7 |
| Tissue specificity | Expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen. Ref.1 Ref.3 |
| Sequence similarities | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily. Contains 1 protein kinase domain. |
| Caution | Cys-176 is present instead of the conserved Lys which is expected to be an active site residue. Lys-159 appears to fulfill the required catalytic function. UniProtKB Q9JIH7 |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Inferred from sequence or structural similarity. Source: UniProtKB protein kinase cascadeInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | ATP binding Inferred from sequence or structural similarity. Source: UniProtKB protein bindingInferred from physical interaction. Source: IntAct protein serine/threonine kinase activityInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BYP7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BYP7-2) The sequence of this isoform differs from the canonical sequence as follows: 1247-1247: G → GGGYFGLSFTCPSLKNPISKKSWTRKLKSWAYRLRQSTSFFKRSKVRQ 1567-1567: D → GKSCLINELEN | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1743 | 1743 | Serine/threonine-protein kinase WNK3 | PRO_0000086823 | |||||
Regions | |||||||||
| Domain | 147 – 405 | 259 | Protein kinase | ||||||
| Nucleotide binding | 153 – 161 | 9 | ATP By similarity UniProtKB Q8TDX7 | ||||||
Sites | |||||||||
| Active site | 275 | 1 | Proton acceptor By similarity UniProtKB Q8TDX7 | ||||||
| Binding site | 159 | 1 | ATP By similarity UniProtKB Q9JIH7 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 304 | 1 | Phosphoserine; by autocatalysis By similarity UniProtKB Q9JIH7 | ||||||
| Modified residue | 308 | 1 | Phosphoserine; by autocatalysis By similarity UniProtKB Q9JIH7 | ||||||
| Modified residue | 734 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1424 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1247 | 1 | G → GGGYFGLSFTCPSLKNPISK KSWTRKLKSWAYRLRQSTSF FKRSKVRQ in isoform 2. | VSP_023375 | |||||
| Alternative sequence | 1567 | 1 | D → GKSCLINELEN in isoform 2. | VSP_023376 | |||||
| Natural variant | 704 | 1 | Q → H: dbSNP rs56077971. Ref.9 | VAR_041323 | |||||
| Natural variant | 854 | 1 | S → C in a lung squamous cell carcinoma sample; somatic mutation. Ref.9 | VAR_041324 | |||||
| Natural variant | 998 | 1 | A → T: dbSNP rs56404148. Ref.9 | VAR_041325 | |||||
| Natural variant | 1169 | 1 | K → E: dbSNP rs55903619. Ref.9 | VAR_041326 | |||||
| Natural variant | 1328 | 1 | T → I: dbSNP rs55879434. Ref.9 | VAR_041327 | |||||
| Natural variant | 1486 | 1 | L → F in a lung large cell carcinoma sample; somatic mutation. Ref.9 | VAR_041328 | |||||
| Natural variant | 1577 | 1 | S → P in a renal clear cell carcinoma sample; somatic mutation. Ref.9 | VAR_041329 | |||||
Experimental info | |||||||||
| Sequence conflict | 10 | 1 | S → N in AAL99253. Ref.3 | ||||||
| Sequence conflict | 431 – 432 | 2 | WV → RD in BAB13392. Ref.5 | ||||||
| Sequence conflict | 1211 | 1 | P → S in BAB13392. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "WNK kinases, a novel protein kinase subfamily in multi-cellular organisms." Verissimo F., Jordan P. Oncogene 20:5562-5569(2001) [PubMed: 11571656] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, CHROMOSOMAL LOCATION. Tissue: Brain. |
| [2] | Jordan P. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO N-TERMINUS. |
| [3] | "Cloning, genomic organization, alternative splicing and expression analysis of the human gene WNK3 (PRKWNK3)." Holden S., Cox J., Raymond F.L. Gene 335:109-119(2004) [PubMed: 15194194] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Brain. |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed: 15772651] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) [PubMed: 10997877] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 431-1743 (ISOFORM 1). Tissue: Brain. |
| [6] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-734, MASS SPECTROMETRY. |
| [7] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [8] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1424, MASS SPECTROMETRY. |
| [9] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-704; CYS-854; THR-998; GLU-1169; ILE-1328; PHE-1486 AND PRO-1577. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ409088 mRNA. Translation: CAC32455.2. AY082340 mRNA. Translation: AAL99253.1. AY352048 mRNA. Translation: AAR89465.1. AL591766, AL049793, Z84469 Genomic DNA. Translation: CAI40708.1. Z84469, AL049793, AL591766 Genomic DNA. Translation: CAI42733.1. AL049793, AL591766, Z84469 Genomic DNA. Translation: CAI43129.1. AB046786 mRNA. Translation: BAB13392.1. |
| IPI | IPI00152474. IPI00387112. |
| RefSeq | NP_001002838.1. NP_065973.2. |
| UniGene | Hs.92423 |
3D structure databases | |
| SMR | Q9BYP7. Positions 137-405. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-46125N. |
| IntAct | Q9BYP7. 1 interaction. |
| STRING | Q9BYP7. |
PTM databases | |
| PhosphoSite | Q9BYP7. |
Proteomic databases | |
| PRIDE | Q9BYP7. |
Genome annotation databases | |
| Ensembl | ENST00000375169; ENSP00000364312; ENSG00000196632; Homo sapiens. [Genome view] |
| GeneID | 65267. |
| KEGG | hsa:65267. |
| UCSC | uc004dtc.1. human. uc004dtd.1. human. |
Organism-specific databases | |
| CTD | 65267. |
| GeneCards | GC0XM054235. |
| H-InvDB | HIX0016821. |
| HGNC | HGNC:14543. WNK3. |
| MIM | 300358. gene. |
| PharmGKB | PA33784. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG06625. |
| HOVERGEN | Q9BYP7. |
| OMA | HLQTGGG. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 247. |
Gene expression databases | |
| ArrayExpress | Q9BYP7. |
| Bgee | Q9BYP7. |
| CleanEx | HS_WNK3. |
| Genevestigator | Q9BYP7. |
| GermOnline | ENSG00000196632. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017442. Se/Thr_prot_kinase-like_dom. IPR008271. Ser/Thr_prot_kinase_AS. IPR002290. Ser/Thr_prot_kinase_dom. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. False negative. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 67402. |
| SOURCE | Search... |
Entry information
| Entry name | WNK3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BYP7 Secondary accession number(s): Q5JRC1 Q9HCK6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


